SimulationCraft 902-01

for World of Warcraft 9.0.2.36639 Live (wow build level 36639)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Pelagos : 16701 dps, 4854 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16701.3 16701.3 23.9 / 0.143% 1584.0 / 9.5% 8.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
1994.3 1905.3 Mana 0.00% 49.5 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 16701
Arcane Barrage 5661 33.9% 54.9 5.41sec 30687 24629 Direct 274.4 5149 10291 6146 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.93 274.36 0.00 0.00 1.2459 0.0000 1685680.97 1685680.97 0.00% 24629.34 24629.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 221.15 165 279 5148.57 2082 32682 5139.75 4540 5624 1138276 1138276 0.00%
crit 19.40% 53.22 28 88 10290.78 4164 63270 10273.77 7081 15291 547405 547405 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:54.94
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 626 3.7% 59.3 4.70sec 3141 0 Direct 296.4 527 1054 628 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.28 296.40 0.00 0.00 0.0000 0.0000 186188.30 186188.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 239.31 178 317 526.86 316 664 526.18 486 564 126053 126053 0.00%
crit 19.26% 57.09 25 88 1053.83 633 1329 1052.58 931 1154 60136 60136 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7488 44.8% 147.4 1.99sec 15105 12162 Direct 736.9 2531 5063 3022 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 147.39 736.94 0.00 0.00 1.2420 0.0000 2226287.50 2226287.50 0.00% 12161.98 12161.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 594.17 460 731 2531.26 1958 6227 2530.40 2440 2629 1503707 1503707 0.00%
crit 19.37% 142.77 94 195 5063.26 3916 12454 5060.43 4667 5588 722581 722581 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:147.40
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1428) 0.0% (8.6%) 12.7 24.12sec 33415 26827

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.71 0.00 0.00 0.00 1.2456 0.0000 0.00 0.00 0.00% 26826.64 26826.64

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.72
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1428 8.6% 63.4 24.12sec 6697 0 Direct 63.4 5621 11183 6698 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 63.44 63.44 0.00 0.00 0.0000 0.0000 424826.70 424826.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 51.15 33 71 5621.21 3869 9669 5621.10 5085 6114 287520 287520 0.00%
crit 19.36% 12.28 2 26 11182.92 7739 19338 11162.22 8284 14362 137306 137306 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (70) 0.0% (0.4%) 14.7 1.73sec 1385 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 70 0.4% 14.7 1.73sec 1385 0 Direct 14.7 1164 2327 1385 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.73 14.73 0.00 0.00 0.0000 0.0000 20401.76 20401.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.97% 11.93 5 19 1163.53 1164 1164 1163.53 1164 1164 13877 13877 0.00%
crit 19.03% 2.80 0 9 2327.06 2327 2327 2210.81 0 2327 6524 6524 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1755 18.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1754.09 1754.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.53% 0.82 0 1 1480.68 1481 1481 1207.26 0 1481 1207 1207 0.00%
crit 18.47% 0.18 0 1 2961.35 2961 2961 546.83 0 2961 547 547 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5796 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5796.06 5796.06 0.00% 49.21 49.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.57% 72.51 56 83 53.94 43 60 53.94 52 55 3911 3911 0.00%
crit 19.43% 17.49 7 34 107.77 86 120 107.75 96 120 1885 1885 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 182 1.1% 9.3 33.74sec 5842 4588 Direct 9.3 2851 5674 3392 19.2%
Periodic 60.2 316 634 377 19.2% 6.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.27 9.27 60.22 60.22 1.2735 1.5124 54129.43 54129.43 0.00% 526.14 4587.63
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.84% 7.49 1 11 2851.36 2693 5655 2857.63 2693 3501 21363 21363 0.00%
crit 19.16% 1.78 0 7 5673.88 5386 11310 4902.47 0 11310 10067 10067 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.76% 48.64 30 67 315.82 34 501 315.51 285 348 15357 15357 0.00%
crit 19.24% 11.59 3 26 634.19 68 1003 634.51 440 860 7343 7343 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.52
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.81
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.98
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (1220) 0.0% (7.3%) 5.9 54.45sec 61204 48737

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.93 0.00 0.00 0.00 1.2559 0.0000 0.00 0.00 0.00% 48737.37 48737.37

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.95
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1220 7.3% 5.9 54.34sec 61204 0 Direct 29.6 12276 0 12276 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.93 29.57 0.00 0.00 0.0000 0.0000 362800.95 362800.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 29.57 25 35 12275.95 85 58535 12263.56 9075 14999 362801 362801 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42922.99
  • base_dd_max:42922.99
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 131.87sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.77
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 263.06sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.77
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 171.48sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.95 0.00 5.64 0.00 4.3098 0.7222 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.95
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.07sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.79 0.00 0.00 0.00 1.2547 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.82
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.88sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.70
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.7 173.8 5.3sec 1.3sec 3.9sec 72.12% 0.00% 25.5 (25.6) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.82%
  • arcane_charge_2:15.97%
  • arcane_charge_3:15.93%
  • arcane_charge_4:21.39%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 132.0sec 132.0sec 14.7sec 13.58% 0.00% 0.0 (0.0) 2.6

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 138.9s
  • trigger_min/max:120.2s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.58%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.6sec 263.6sec 11.7sec 6.84% 23.03% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.6s / 272.1s
  • trigger_min/max:240.6s / 272.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:6.84%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.5 0.2 12.2sec 12.1sec 2.1sec 16.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.18%
  • clearcasting_2:0.23%
  • clearcasting_3:0.06%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.9 0.0 67.5sec 67.5sec 7.9sec 12.95% 0.00% 9.6 (9.6) 4.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:62.7s / 88.0s
  • trigger_min/max:62.7s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • combat_meditation_1:12.95%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 0.9 0.0 170.6sec 170.6sec 4.3sec 1.37% 0.00% 3.8 (3.8) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:114.1s / 239.5s
  • trigger_min/max:114.1s / 239.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.37%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.52%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.2sec 36.2sec 11.8sec 33.82% 0.00% 0.0 (0.0) 8.2

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 55.3s
  • trigger_min/max:14.4s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:33.82%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.55% 0.83% 6.87% 0.8s 0.0s 5.2s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000177.405120.026239.962
Evocation174.26624.095330.011229.071137.253355.859
Rune of Power8.0211.13624.68748.14231.83477.489
Touch of the Magi6.9201.13723.38642.49130.52876.182
Arcane Power8.4830.23318.92824.0302.70234.456
Arcane Barrage2.9170.0039.588161.427129.263196.640
Arcane Orb4.0540.01211.97651.88739.43768.844
Radiant Spark2.2110.00022.28421.0089.68958.622

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 623.03 369116.93 65.13% 592.46 11866.92 3.11%
Evocation Mana 45.11 45490.96 8.03% 1008.49 0.00 0.00%
Mana Gem Mana 2.70 17488.55 3.09% 6485.48 0.00 0.00%
Arcane Barrage Mana 54.94 134599.57 23.75% 2450.05 6935.38 4.90%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1905.35 1994.35 18753.5 35815.8 398.0 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 147.4 562423.0 3815.6 3815.9 4.0
arcane_orb Mana 12.7 5684.0 446.9 447.1 74.7
radiant_spark Mana 9.3 9158.3 988.0 988.4 5.9
touch_of_the_magi Mana 5.9 14821.9 2500.0 2500.4 24.5

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
Kyrian_Pelagos Damage Per Second
Count 1121
Mean 16701.27
Minimum 15405.14
Maximum 17894.94
Spread ( max - min ) 2489.81
Range [ ( max - min ) / 2 * 100% ] 7.45%
Standard Deviation 407.9692
5th Percentile 16025.71
95th Percentile 17353.75
( 95th Percentile - 5th Percentile ) 1328.04
Mean Distribution
Standard Deviation 12.1850
95.00% Confidence Interval ( 16677.39 - 16725.16 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2293
0.1 Scale Factor Error with Delta=300 1421
0.05 Scale Factor Error with Delta=300 5684
0.01 Scale Factor Error with Delta=300 142082
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1121
Mean 4854.23
Minimum 4341.17
Maximum 5445.33
Spread ( max - min ) 1104.15
Range [ ( max - min ) / 2 * 100% ] 11.37%
Standard Deviation 182.4253
5th Percentile 4563.95
95th Percentile 5155.21
( 95th Percentile - 5th Percentile ) 591.26
Mean Distribution
Standard Deviation 5.4486
95.00% Confidence Interval ( 4843.55 - 4864.91 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5426
0.1 Scale Factor Error with Delta=300 285
0.05 Scale Factor Error with Delta=300 1137
0.01 Scale Factor Error with Delta=300 28409
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1121
Mean 16701.27
Minimum 15405.14
Maximum 17894.94
Spread ( max - min ) 2489.81
Range [ ( max - min ) / 2 * 100% ] 7.45%
Damage
Kyrian_Pelagos Damage
Count 1121
Mean 4962069.71
Minimum 3821060.02
Maximum 6072836.21
Spread ( max - min ) 2251776.18
Range [ ( max - min ) / 2 * 100% ] 22.69%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.52 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.81 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.98 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.95 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.77 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.82 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.72 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 147.40 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 54.94 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.95 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.70 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.77 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqsqrmorprqqqqrjqqqqrqqqqrprqqqqnvrqqqqtrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe m touch_of_the_magi Fluffy_Pillow 68282.3/69371: 98% mana bloodlust, combat_meditation
0:02.313 aoe n arcane_power Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), combat_meditation
0:02.313 shared_cds u potion Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
0:02.313 shared_cds v berserking Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:02.313 aoe r arcane_barrage Fluffy_Pillow 66878.4/69371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:03.228 aoe p arcane_orb Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:04.141 aoe r arcane_barrage Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.054 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.968 aoe q arcane_explosion Fluffy_Pillow 68139.5/69371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:06.881 aoe q arcane_explosion Fluffy_Pillow 66906.3/69371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:07.795 aoe q arcane_explosion Fluffy_Pillow 65674.4/69371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:08.708 aoe r arcane_barrage Fluffy_Pillow 64441.1/69371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:09.626 aoe q arcane_explosion Fluffy_Pillow 62565.9/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.540 aoe q arcane_explosion Fluffy_Pillow 61224.3/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.454 aoe q arcane_explosion Fluffy_Pillow 59882.7/63371: 94% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.368 aoe q arcane_explosion Fluffy_Pillow 58541.2/63371: 92% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.282 aoe r arcane_barrage Fluffy_Pillow 57199.6/63371: 90% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.196 aoe q arcane_explosion Fluffy_Pillow 60892.9/63371: 96% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.109 aoe q arcane_explosion Fluffy_Pillow 59550.0/63371: 94% mana bloodlust, arcane_charge, arcane_power, clearcasting, potion_of_deathly_fixation
0:16.116 aoe q arcane_explosion Fluffy_Pillow 60826.3/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:17.122 aoe q arcane_explosion Fluffy_Pillow 59601.4/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:18.126 aoe o rune_of_power Fluffy_Pillow 58373.9/63371: 92% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.130 aoe r arcane_barrage Fluffy_Pillow 59646.4/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.135 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.142 aoe q arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.148 aoe q arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.156 shared_cds t use_mana_gem Kyrian_Pelagos 52200.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.156 aoe q arcane_explosion Fluffy_Pillow 58537.5/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.164 aoe r arcane_barrage Fluffy_Pillow 54815.0/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.171 aoe p arcane_orb Fluffy_Pillow 58626.2/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.178 aoe r arcane_barrage Fluffy_Pillow 59402.5/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.185 aoe q arcane_explosion Fluffy_Pillow 63213.7/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.192 aoe q arcane_explosion Fluffy_Pillow 59490.0/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.198 aoe q arcane_explosion Fluffy_Pillow 55765.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.203 aoe q arcane_explosion Fluffy_Pillow 52038.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.209 aoe r arcane_barrage Fluffy_Pillow 48313.8/63371: 76% mana bloodlust, arcane_charge(4)
0:32.216 aoe j radiant_spark Fluffy_Pillow 52124.9/63371: 82% mana bloodlust
0:33.223 aoe q arcane_explosion Fluffy_Pillow 52401.2/63371: 83% mana bloodlust
0:34.230 aoe q arcane_explosion Fluffy_Pillow 48677.5/63371: 77% mana bloodlust, arcane_charge
0:35.235 aoe q arcane_explosion Fluffy_Pillow 44951.3/63371: 71% mana bloodlust, arcane_charge(2), clearcasting
0:36.242 aoe q arcane_explosion Fluffy_Pillow 46227.6/63371: 73% mana bloodlust, arcane_charge(3)
0:37.248 aoe r arcane_barrage Fluffy_Pillow 42502.6/63371: 67% mana bloodlust, arcane_charge(4), clearcasting
0:38.253 aoe q arcane_explosion Fluffy_Pillow 46311.3/63371: 73% mana bloodlust, clearcasting
0:39.262 aoe q arcane_explosion Fluffy_Pillow 47590.1/63371: 75% mana bloodlust, arcane_charge
0:40.269 aoe q arcane_explosion Fluffy_Pillow 43866.4/63371: 69% mana bloodlust, arcane_charge(2)
0:41.275 aoe q arcane_explosion Fluffy_Pillow 40141.4/63371: 63% mana arcane_charge(3), clearcasting
0:42.582 aoe r arcane_barrage Fluffy_Pillow 41798.0/63371: 66% mana arcane_charge(4)
0:43.889 aoe q arcane_explosion Fluffy_Pillow 45989.4/63371: 73% mana
0:45.195 aoe q arcane_explosion Fluffy_Pillow 42644.6/63371: 67% mana arcane_charge
0:46.501 aoe q arcane_explosion Fluffy_Pillow 39299.9/63371: 62% mana arcane_charge(2), clearcasting
0:47.807 aoe q arcane_explosion Fluffy_Pillow 40955.1/63371: 65% mana arcane_charge(3)
0:49.113 aoe r arcane_barrage Fluffy_Pillow 37610.4/63371: 59% mana arcane_charge(4), clearcasting
0:50.420 aoe p arcane_orb Fluffy_Pillow 41801.8/63371: 66% mana clearcasting
0:51.727 aoe r arcane_barrage Fluffy_Pillow 42958.3/63371: 68% mana arcane_charge(4), clearcasting
0:53.035 aoe q arcane_explosion Fluffy_Pillow 47151.0/63371: 74% mana clearcasting
0:54.342 aoe q arcane_explosion Fluffy_Pillow 48807.5/63371: 77% mana arcane_charge
0:55.648 aoe q arcane_explosion Fluffy_Pillow 45462.8/63371: 72% mana arcane_charge(2), clearcasting
0:56.953 aoe q arcane_explosion Fluffy_Pillow 47116.8/63371: 74% mana arcane_charge(3)
0:58.258 aoe r arcane_barrage Fluffy_Pillow 43770.8/63371: 69% mana arcane_charge(4)
0:59.565 aoe q arcane_explosion Fluffy_Pillow 47962.1/63371: 76% mana
1:00.870 aoe q arcane_explosion Fluffy_Pillow 44616.1/63371: 70% mana arcane_charge
1:02.176 aoe q arcane_explosion Fluffy_Pillow 41271.4/63371: 65% mana arcane_charge(2)
1:03.482 aoe q arcane_explosion Fluffy_Pillow 37926.7/63371: 60% mana arcane_charge(3)
1:04.790 aoe r arcane_barrage Fluffy_Pillow 34584.5/63371: 55% mana arcane_charge(4)
1:06.095 aoe k radiant_spark Fluffy_Pillow 38773.3/63371: 61% mana
1:07.399 aoe m touch_of_the_magi Fluffy_Pillow 43158.9/69371: 62% mana combat_meditation
1:08.706 aoe o rune_of_power Fluffy_Pillow 42472.3/69371: 61% mana arcane_charge(4), clearcasting, combat_meditation
1:10.012 aoe r arcane_barrage Fluffy_Pillow 44284.2/69371: 64% mana arcane_charge(4), clearcasting, rune_of_power, combat_meditation
1:11.318 aoe p arcane_orb Fluffy_Pillow 48871.1/69371: 70% mana clearcasting, rune_of_power, combat_meditation
1:12.626 aoe r arcane_barrage Fluffy_Pillow 50185.8/69371: 72% mana arcane_charge(4), clearcasting, rune_of_power, combat_meditation
1:13.933 aoe q arcane_explosion Fluffy_Pillow 54774.1/69371: 79% mana clearcasting, rune_of_power, combat_meditation
1:15.239 aoe q arcane_explosion Fluffy_Pillow 56586.0/69371: 82% mana arcane_charge, rune_of_power, combat_meditation
1:16.545 aoe q arcane_explosion Fluffy_Pillow 48779.6/63371: 77% mana arcane_charge(2), rune_of_power
1:17.851 aoe q arcane_explosion Fluffy_Pillow 45434.8/63371: 72% mana arcane_charge(3), rune_of_power
1:19.156 aoe r arcane_barrage Fluffy_Pillow 42088.8/63371: 66% mana arcane_charge(4), rune_of_power
1:20.464 aoe q arcane_explosion Fluffy_Pillow 46281.5/63371: 73% mana rune_of_power
1:21.770 aoe q arcane_explosion Fluffy_Pillow 42936.7/63371: 68% mana arcane_charge, rune_of_power
1:23.075 aoe q arcane_explosion Fluffy_Pillow 39590.7/63371: 62% mana arcane_charge(2)
1:24.382 aoe q arcane_explosion Fluffy_Pillow 36247.3/63371: 57% mana arcane_charge(3)
1:25.688 aoe r arcane_barrage Fluffy_Pillow 32902.5/63371: 52% mana arcane_charge(4)
1:26.996 aoe q arcane_explosion Fluffy_Pillow 37095.2/63371: 59% mana
1:28.303 aoe q arcane_explosion Fluffy_Pillow 33751.7/63371: 53% mana arcane_charge
1:29.609 aoe q arcane_explosion Fluffy_Pillow 30407.0/63371: 48% mana arcane_charge(2), clearcasting
1:30.916 aoe q arcane_explosion Fluffy_Pillow 32063.5/63371: 51% mana arcane_charge(3)
1:32.223 aoe r arcane_barrage Fluffy_Pillow 28720.0/63371: 45% mana arcane_charge(4)
1:33.530 aoe p arcane_orb Fluffy_Pillow 32911.4/63371: 52% mana
1:34.837 aoe r arcane_barrage Fluffy_Pillow 34067.9/63371: 54% mana arcane_charge(4)
1:36.143 aoe q arcane_explosion Fluffy_Pillow 38258.1/63371: 60% mana
1:37.449 aoe j radiant_spark Fluffy_Pillow 34913.3/63371: 55% mana arcane_charge
1:38.756 aoe q arcane_explosion Fluffy_Pillow 35569.9/63371: 56% mana arcane_charge
1:40.065 aoe q arcane_explosion Fluffy_Pillow 32228.9/63371: 51% mana arcane_charge(2)
1:41.371 aoe q arcane_explosion Fluffy_Pillow 28884.2/63371: 46% mana arcane_charge(3)
1:42.677 aoe r arcane_barrage Fluffy_Pillow 25539.4/63371: 40% mana arcane_charge(4), clearcasting
1:43.983 aoe q arcane_explosion Fluffy_Pillow 29729.6/63371: 47% mana clearcasting
1:45.289 aoe q arcane_explosion Fluffy_Pillow 31384.8/63371: 50% mana arcane_charge
1:46.597 aoe q arcane_explosion Fluffy_Pillow 28042.6/63371: 44% mana arcane_charge(2)
1:47.905 aoe q arcane_explosion Fluffy_Pillow 24700.4/63371: 39% mana arcane_charge(3)
1:49.212 aoe r arcane_barrage Fluffy_Pillow 21356.9/63371: 34% mana arcane_charge(4), clearcasting
1:50.519 aoe q arcane_explosion Fluffy_Pillow 25548.3/63371: 40% mana clearcasting
1:51.825 aoe q arcane_explosion Fluffy_Pillow 27203.6/63371: 43% mana arcane_charge
1:53.131 aoe q arcane_explosion Fluffy_Pillow 23858.9/63371: 38% mana arcane_charge(2)
1:54.437 aoe q arcane_explosion Fluffy_Pillow 20514.1/63371: 32% mana arcane_charge(3)
1:55.742 aoe r arcane_barrage Fluffy_Pillow 17168.1/63371: 27% mana arcane_charge(4)
1:57.051 aoe m touch_of_the_magi Fluffy_Pillow 21362.0/63371: 34% mana
1:58.357 aoe o rune_of_power Fluffy_Pillow 20517.3/63371: 32% mana arcane_charge(4)
1:59.663 aoe r arcane_barrage Fluffy_Pillow 22172.6/63371: 35% mana arcane_charge(4), rune_of_power
2:00.972 aoe p arcane_orb Fluffy_Pillow 26366.5/63371: 42% mana rune_of_power
2:02.278 aoe r arcane_barrage Fluffy_Pillow 27521.7/63371: 43% mana arcane_charge(4), rune_of_power
2:03.585 aoe q arcane_explosion Fluffy_Pillow 31713.1/63371: 50% mana rune_of_power
2:04.892 aoe q arcane_explosion Fluffy_Pillow 28369.7/63371: 45% mana arcane_charge, rune_of_power
2:06.198 aoe q arcane_explosion Fluffy_Pillow 25024.9/63371: 39% mana arcane_charge(2), rune_of_power
2:07.506 aoe q arcane_explosion Fluffy_Pillow 21682.7/63371: 34% mana arcane_charge(3), rune_of_power
2:08.813 aoe r arcane_barrage Fluffy_Pillow 18339.2/63371: 29% mana arcane_charge(4), rune_of_power
2:10.119 aoe q arcane_explosion Fluffy_Pillow 22529.4/63371: 36% mana rune_of_power
2:11.426 aoe q arcane_explosion Fluffy_Pillow 19185.9/63371: 30% mana arcane_charge, clearcasting, rune_of_power
2:12.733 aoe q arcane_explosion Fluffy_Pillow 20842.4/63371: 33% mana arcane_charge(2)
2:14.039 aoe q arcane_explosion Fluffy_Pillow 17497.7/63371: 28% mana arcane_charge(3)
2:15.344 aoe l radiant_spark Fluffy_Pillow 14151.7/63371: 22% mana arcane_charge(4)
2:16.652 aoe n arcane_power Fluffy_Pillow 16211.6/69371: 23% mana arcane_charge(4), combat_meditation
2:16.652 aoe r arcane_barrage Fluffy_Pillow 16211.6/69371: 23% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:17.960 aoe q arcane_explosion Fluffy_Pillow 20801.2/69371: 30% mana arcane_power, rune_of_power, combat_meditation
2:19.265 aoe q arcane_explosion Fluffy_Pillow 20111.8/69371: 29% mana arcane_charge, arcane_power, rune_of_power, combat_meditation
2:20.573 aoe q arcane_explosion Fluffy_Pillow 19426.6/69371: 28% mana arcane_charge(2), arcane_power, rune_of_power, combat_meditation
2:21.879 aoe q arcane_explosion Fluffy_Pillow 18738.6/69371: 27% mana arcane_charge(3), arcane_power, rune_of_power, combat_meditation
2:23.185 shared_cds t use_mana_gem Kyrian_Pelagos 18050.6/69371: 26% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:23.185 aoe r arcane_barrage Fluffy_Pillow 24987.7/69371: 36% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:24.491 aoe p arcane_orb Fluffy_Pillow 29574.5/69371: 43% mana arcane_power, rune_of_power, combat_meditation
2:25.795 aoe r arcane_barrage Fluffy_Pillow 28441.0/63371: 45% mana arcane_charge(4), arcane_power, rune_of_power
2:27.102 aoe q arcane_explosion Fluffy_Pillow 32632.3/63371: 51% mana arcane_power, rune_of_power
2:28.409 aoe q arcane_explosion Fluffy_Pillow 31788.9/63371: 50% mana arcane_charge, arcane_power, rune_of_power
2:29.715 aoe q arcane_explosion Fluffy_Pillow 30944.1/63371: 49% mana arcane_charge(2), arcane_power
2:31.022 aoe q arcane_explosion Fluffy_Pillow 30100.7/63371: 47% mana arcane_charge(3), arcane_power
2:32.327 aoe r arcane_barrage Fluffy_Pillow 29254.7/63371: 46% mana arcane_charge(4)
2:33.634 aoe q arcane_explosion Fluffy_Pillow 33446.0/63371: 53% mana
2:34.940 aoe q arcane_explosion Fluffy_Pillow 30101.3/63371: 47% mana arcane_charge
2:36.247 aoe q arcane_explosion Fluffy_Pillow 26757.8/63371: 42% mana arcane_charge(2), clearcasting
2:37.555 aoe q arcane_explosion Fluffy_Pillow 28415.6/63371: 45% mana arcane_charge(3)
2:38.861 aoe r arcane_barrage Fluffy_Pillow 25070.9/63371: 40% mana arcane_charge(4)
2:40.166 aoe q arcane_explosion Fluffy_Pillow 29259.7/63371: 46% mana
2:41.472 aoe q arcane_explosion Fluffy_Pillow 25915.0/63371: 41% mana arcane_charge
2:42.780 aoe q arcane_explosion Fluffy_Pillow 22572.8/63371: 36% mana arcane_charge(2)
2:44.086 aoe q arcane_explosion Fluffy_Pillow 19228.1/63371: 30% mana arcane_charge(3)
2:45.393 aoe r arcane_barrage Fluffy_Pillow 15884.6/63371: 25% mana arcane_charge(4)
2:46.701 aoe k radiant_spark Fluffy_Pillow 20077.3/63371: 32% mana
2:48.007 aoe m touch_of_the_magi Fluffy_Pillow 20732.5/63371: 33% mana
2:49.313 aoe o rune_of_power Fluffy_Pillow 19887.8/63371: 31% mana arcane_charge(4)
2:50.619 aoe r arcane_barrage Fluffy_Pillow 21543.0/63371: 34% mana arcane_charge(4), rune_of_power
2:51.924 aoe p arcane_orb Fluffy_Pillow 25731.9/63371: 41% mana rune_of_power
2:53.230 aoe r arcane_barrage Fluffy_Pillow 26887.2/63371: 42% mana arcane_charge(4), rune_of_power
2:54.537 aoe q arcane_explosion Fluffy_Pillow 31078.5/63371: 49% mana rune_of_power
2:55.843 aoe q arcane_explosion Fluffy_Pillow 27733.8/63371: 44% mana arcane_charge, rune_of_power
2:57.148 aoe q arcane_explosion Fluffy_Pillow 24387.8/63371: 38% mana arcane_charge(2), rune_of_power
2:58.453 aoe q arcane_explosion Fluffy_Pillow 21041.8/63371: 33% mana arcane_charge(3), rune_of_power
2:59.760 aoe r arcane_barrage Fluffy_Pillow 17698.3/63371: 28% mana arcane_charge(4), rune_of_power
3:01.067 aoe q arcane_explosion Fluffy_Pillow 21889.7/63371: 35% mana rune_of_power
3:02.373 aoe q arcane_explosion Fluffy_Pillow 18545.0/63371: 29% mana arcane_charge, rune_of_power
3:03.680 aoe q arcane_explosion Fluffy_Pillow 15201.5/63371: 24% mana arcane_charge(2)
3:04.986 aoe q arcane_explosion Fluffy_Pillow 11856.8/63371: 19% mana arcane_charge(3), clearcasting
3:06.292 aoe r arcane_barrage Fluffy_Pillow 13512.0/63371: 21% mana arcane_charge(4)
3:07.600 aoe q arcane_explosion Fluffy_Pillow 17704.7/63371: 28% mana
3:08.907 aoe q arcane_explosion Fluffy_Pillow 14361.2/63371: 23% mana arcane_charge
3:10.216 aoe q arcane_explosion Fluffy_Pillow 11020.3/63371: 17% mana arcane_charge(2)
3:11.524 aoe q arcane_explosion Fluffy_Pillow 7678.1/63371: 12% mana arcane_charge(3), clearcasting
3:12.830 aoe r arcane_barrage Fluffy_Pillow 9333.3/63371: 15% mana arcane_charge(4)
3:14.136 aoe p arcane_orb Fluffy_Pillow 13523.4/63371: 21% mana
3:15.442 aoe r arcane_barrage Fluffy_Pillow 14678.7/63371: 23% mana arcane_charge(4)
3:16.748 aoe q arcane_explosion Fluffy_Pillow 18868.8/63371: 30% mana
3:18.055 aoe j radiant_spark Fluffy_Pillow 15525.4/63371: 24% mana arcane_charge
3:19.361 aoe q arcane_explosion Fluffy_Pillow 17712.6/69371: 26% mana arcane_charge, combat_meditation
3:20.666 aoe q arcane_explosion Fluffy_Pillow 14523.2/69371: 21% mana arcane_charge(2), combat_meditation
3:21.972 aoe q arcane_explosion Fluffy_Pillow 11335.2/69371: 16% mana arcane_charge(3), combat_meditation
3:23.277 aoe r arcane_barrage Fluffy_Pillow 8145.8/69371: 12% mana arcane_charge(4), combat_meditation
3:24.583 aoe q arcane_explosion Fluffy_Pillow 12732.6/69371: 18% mana combat_meditation
3:25.890 aoe q arcane_explosion Fluffy_Pillow 9546.0/69371: 14% mana arcane_charge, combat_meditation
3:27.197 aoe q arcane_explosion Fluffy_Pillow 6359.3/69371: 9% mana arcane_charge(2), clearcasting, combat_meditation
3:28.503 aoe q arcane_explosion Fluffy_Pillow 7464.6/63371: 12% mana arcane_charge(3)
3:29.810 aoe r arcane_barrage Fluffy_Pillow 4121.1/63371: 7% mana arcane_charge(4)
3:31.116 aoe q arcane_explosion Fluffy_Pillow 8311.2/63371: 13% mana
3:32.423 aoe q arcane_explosion Fluffy_Pillow 4967.8/63371: 8% mana arcane_charge, clearcasting
3:33.730 aoe q arcane_explosion Fluffy_Pillow 6624.3/63371: 10% mana arcane_charge(2)
3:35.035 aoe s evocation Kyrian_Pelagos 3278.3/63371: 5% mana arcane_charge(3)
3:39.380 aoe q arcane_explosion Fluffy_Pillow 57124.2/63371: 90% mana arcane_charge(3)
3:40.686 aoe r arcane_barrage Fluffy_Pillow 53779.5/63371: 85% mana arcane_charge(4)
3:41.993 aoe m touch_of_the_magi Fluffy_Pillow 57970.9/63371: 91% mana
3:43.299 aoe o rune_of_power Fluffy_Pillow 57126.1/63371: 90% mana arcane_charge(4)
3:44.607 aoe r arcane_barrage Fluffy_Pillow 58783.9/63371: 93% mana arcane_charge(4), rune_of_power
3:45.913 aoe p arcane_orb Fluffy_Pillow 62974.0/63371: 99% mana rune_of_power
3:47.218 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
3:48.523 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:49.830 aoe q arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
3:51.137 aoe q arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting, rune_of_power
3:52.444 aoe q arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3), rune_of_power
3:53.752 aoe r arcane_barrage Fluffy_Pillow 54998.8/63371: 87% mana arcane_charge(4), rune_of_power
3:55.059 aoe j radiant_spark Fluffy_Pillow 59190.2/63371: 93% mana rune_of_power
3:56.366 aoe q arcane_explosion Fluffy_Pillow 59846.7/63371: 94% mana rune_of_power
3:57.675 aoe q arcane_explosion Fluffy_Pillow 56505.8/63371: 89% mana arcane_charge
3:58.981 aoe q arcane_explosion Fluffy_Pillow 53161.1/63371: 84% mana arcane_charge(2)
4:00.287 aoe q arcane_explosion Fluffy_Pillow 49816.3/63371: 79% mana arcane_charge(3), clearcasting
4:01.593 aoe r arcane_barrage Fluffy_Pillow 51471.6/63371: 81% mana arcane_charge(4)
4:02.899 aoe q arcane_explosion Fluffy_Pillow 55661.7/63371: 88% mana
4:04.207 aoe q arcane_explosion Fluffy_Pillow 52319.5/63371: 83% mana arcane_charge
4:05.514 aoe q arcane_explosion Fluffy_Pillow 48976.0/63371: 77% mana arcane_charge(2)
4:06.819 aoe q arcane_explosion Fluffy_Pillow 45630.0/63371: 72% mana arcane_charge(3)
4:08.127 aoe r arcane_barrage Fluffy_Pillow 42287.8/63371: 67% mana arcane_charge(4), clearcasting
4:09.433 aoe p arcane_orb Fluffy_Pillow 46477.9/63371: 73% mana clearcasting
4:10.739 aoe r arcane_barrage Fluffy_Pillow 47633.2/63371: 75% mana arcane_charge(4), clearcasting
4:12.046 aoe q arcane_explosion Fluffy_Pillow 51824.6/63371: 82% mana clearcasting
4:13.353 aoe q arcane_explosion Fluffy_Pillow 53481.1/63371: 84% mana arcane_charge
4:14.658 aoe q arcane_explosion Fluffy_Pillow 50135.1/63371: 79% mana arcane_charge(2)
4:15.963 aoe q arcane_explosion Fluffy_Pillow 46789.1/63371: 74% mana arcane_charge(3)
4:17.269 aoe n arcane_power Fluffy_Pillow 43444.4/63371: 69% mana arcane_charge(4)
4:17.269 shared_cds v berserking Fluffy_Pillow 43444.4/63371: 69% mana arcane_charge(4), arcane_power, rune_of_power
4:17.269 aoe r arcane_barrage Fluffy_Pillow 43444.4/63371: 69% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:18.457 aoe q arcane_explosion Fluffy_Pillow 47484.9/63371: 75% mana berserking, arcane_power, rune_of_power
4:19.645 aoe q arcane_explosion Fluffy_Pillow 46490.6/63371: 73% mana berserking, arcane_charge, arcane_power, rune_of_power
4:20.834 aoe q arcane_explosion Fluffy_Pillow 45497.6/63371: 72% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:22.022 aoe q arcane_explosion Fluffy_Pillow 44503.3/63371: 70% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:23.211 shared_cds t use_mana_gem Kyrian_Pelagos 43510.3/63371: 69% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:23.211 aoe r arcane_barrage Fluffy_Pillow 49847.4/63371: 79% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:24.400 aoe q arcane_explosion Fluffy_Pillow 53889.2/63371: 85% mana berserking, arcane_power, rune_of_power
4:25.589 aoe q arcane_explosion Fluffy_Pillow 52896.2/63371: 83% mana berserking, arcane_charge, arcane_power, rune_of_power
4:26.776 aoe q arcane_explosion Fluffy_Pillow 51900.7/63371: 82% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
4:27.963 aoe q arcane_explosion Fluffy_Pillow 53405.1/63371: 84% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:29.152 aoe r arcane_barrage Fluffy_Pillow 52412.1/63371: 83% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:30.340 aoe k radiant_spark Fluffy_Pillow 56452.6/63371: 89% mana arcane_power, clearcasting
4:31.646 aoe m touch_of_the_magi Fluffy_Pillow 63062.2/69371: 91% mana arcane_power, clearcasting, combat_meditation
4:32.954 aoe o rune_of_power Fluffy_Pillow 62377.0/69371: 90% mana arcane_charge(4), clearcasting, combat_meditation
4:34.262 aoe r arcane_barrage Fluffy_Pillow 64191.7/69371: 93% mana arcane_charge(4), clearcasting, rune_of_power, combat_meditation
4:35.569 aoe p arcane_orb Fluffy_Pillow 68779.9/69371: 99% mana clearcasting, rune_of_power, combat_meditation
4:36.876 aoe r arcane_barrage Fluffy_Pillow 69371.4/69371: 100% mana arcane_charge(4), clearcasting, rune_of_power, combat_meditation
4:38.182 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana clearcasting, rune_of_power, combat_meditation
4:39.487 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana arcane_charge, rune_of_power, combat_meditation
4:40.794 aoe q arcane_explosion Fluffy_Pillow 60460.4/63371: 95% mana arcane_charge(2), rune_of_power
4:42.101 aoe q arcane_explosion Fluffy_Pillow 57116.9/63371: 90% mana arcane_charge(3), rune_of_power
4:43.408 aoe r arcane_barrage Fluffy_Pillow 53773.5/63371: 85% mana arcane_charge(4), rune_of_power
4:44.714 aoe q arcane_explosion Fluffy_Pillow 57963.6/63371: 91% mana rune_of_power
4:46.020 aoe q arcane_explosion Fluffy_Pillow 54618.9/63371: 86% mana arcane_charge, rune_of_power
4:47.326 aoe q arcane_explosion Fluffy_Pillow 51274.1/63371: 81% mana arcane_charge(2)
4:48.633 aoe q arcane_explosion Fluffy_Pillow 47930.6/63371: 76% mana arcane_charge(3)
4:49.940 aoe r arcane_barrage Fluffy_Pillow 44587.2/63371: 70% mana arcane_charge(4)
4:51.247 aoe q arcane_explosion Fluffy_Pillow 48778.6/63371: 77% mana
4:52.554 aoe q arcane_explosion Fluffy_Pillow 45435.1/63371: 72% mana arcane_charge
4:53.863 aoe q arcane_explosion Fluffy_Pillow 42094.2/63371: 66% mana arcane_charge(2)
4:55.170 aoe q arcane_explosion Fluffy_Pillow 38750.7/63371: 61% mana arcane_charge(3), clearcasting
4:56.476 aoe r arcane_barrage Fluffy_Pillow 40405.9/63371: 64% mana arcane_charge(4)
4:57.782 aoe p arcane_orb Fluffy_Pillow 44596.1/63371: 70% mana
4:59.089 aoe r arcane_barrage Fluffy_Pillow 45752.6/63371: 72% mana arcane_charge(4)
5:00.395 aoe q arcane_explosion Fluffy_Pillow 49942.7/63371: 79% mana
5:01.702 aoe j radiant_spark Fluffy_Pillow 46599.2/63371: 74% mana arcane_charge, clearcasting
5:03.008 aoe q arcane_explosion Fluffy_Pillow 47254.5/63371: 75% mana arcane_charge, clearcasting
5:04.313 aoe q arcane_explosion Fluffy_Pillow 48908.5/63371: 77% mana arcane_charge(2)
5:05.619 aoe q arcane_explosion Fluffy_Pillow 45563.8/63371: 72% mana arcane_charge(3)
5:06.927 aoe r arcane_barrage Fluffy_Pillow 42221.6/63371: 67% mana arcane_charge(4)
5:08.233 aoe q arcane_explosion Fluffy_Pillow 46411.7/63371: 73% mana
5:09.540 aoe q arcane_explosion Fluffy_Pillow 43068.2/63371: 68% mana arcane_charge
5:10.847 aoe q arcane_explosion Fluffy_Pillow 39724.7/63371: 63% mana arcane_charge(2)
5:12.156 aoe q arcane_explosion Fluffy_Pillow 36383.8/63371: 57% mana arcane_charge(3)
5:13.462 aoe r arcane_barrage Fluffy_Pillow 33039.1/63371: 52% mana arcane_charge(4), clearcasting
5:14.770 aoe q arcane_explosion Fluffy_Pillow 37231.7/63371: 59% mana clearcasting
5:16.075 aoe q arcane_explosion Fluffy_Pillow 38885.7/63371: 61% mana arcane_charge
5:17.381 aoe q arcane_explosion Fluffy_Pillow 35541.0/63371: 56% mana arcane_charge(2), clearcasting
5:18.686 aoe q arcane_explosion Fluffy_Pillow 37195.0/63371: 59% mana arcane_charge(3)
5:19.992 aoe r arcane_barrage Fluffy_Pillow 33850.2/63371: 53% mana arcane_charge(4)
5:21.298 aoe m touch_of_the_magi Fluffy_Pillow 38040.3/63371: 60% mana
5:22.604 aoe o rune_of_power Fluffy_Pillow 37195.6/63371: 59% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=328266//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Emeni : 17094 dps, 4699 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17094.0 17094.0 32.5 / 0.190% 2132.9 / 12.5% 8.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2048.2 1943.8 Mana 0.00% 49.6 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 17094
Arcane Barrage 5994 35.1% 56.3 5.27sec 31708 25427 Direct 281.2 5325 10674 6352 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.30 281.17 0.00 0.00 1.2471 0.0000 1785271.24 1785271.24 0.00% 25426.51 25426.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.81% 227.22 174 293 5325.27 2082 31802 5314.29 4575 5886 1209565 1209565 0.00%
crit 19.19% 53.96 31 81 10674.16 4164 63605 10650.41 8027 14324 575707 575707 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [q]:56.31
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [t]:0.00
Arcane Blast 0 0.0% 0.0 0.00sec 2648 2363 Direct 0.0 0 2648 2648 100.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.3050 0.0000 2.36 2.36 0.00% 2362.54 2362.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 0.00 0 1 2648.41 2648 2648 2.36 0 2648 2 2 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [s]:0.00
Arcane Echo 434 2.5% 36.1 7.79sec 3570 0 Direct 180.6 599 1198 714 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.12 180.62 0.00 0.00 0.0000 0.0000 128952.82 128952.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 145.90 104 194 598.87 443 841 597.94 544 639 87344 87344 0.00%
crit 19.22% 34.72 17 58 1198.29 886 1681 1196.75 965 1416 41609 41609 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 8103 47.4% 152.3 1.92sec 15822 12742 Direct 761.5 2655 5310 3165 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.29 761.46 0.00 0.00 1.2417 0.0000 2409567.32 2409567.32 0.00% 12741.95 12741.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 615.06 484 757 2654.72 1958 5201 2652.83 2518 2794 1632396 1632396 0.00%
crit 19.23% 146.40 100 206 5309.63 3916 10402 5306.46 4786 5847 777172 777172 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [p]:152.31
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1446) 0.0% (8.4%) 12.9 23.70sec 33284 26709

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.91 0.00 0.00 0.00 1.2462 0.0000 0.00 0.00 0.00% 26709.25 26709.25

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [o]:12.91
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1446 8.4% 64.4 23.70sec 6672 0 Direct 64.4 5587 11177 6673 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.41 64.41 0.00 0.00 0.0000 0.0000 429725.09 429725.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 51.89 32 71 5587.01 3869 10279 5584.72 4805 6437 289854 289854 0.00%
crit 19.44% 12.52 3 23 11177.36 7739 20558 11161.77 7739 15451 139871 139871 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (70) 0.0% (0.4%) 14.8 1.74sec 1389 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 70 0.4% 14.8 1.74sec 1389 0 Direct 14.8 1164 2327 1390 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.78 14.78 0.00 0.00 0.0000 0.0000 20518.01 20518.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 11.92 5 21 1163.53 1164 1164 1163.53 1164 1164 13869 13869 0.00%
crit 19.34% 2.86 0 9 2327.06 2327 2327 2194.21 0 2327 6649 6649 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1768 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1768.62 1768.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 0.81 0 1 1480.68 1481 1481 1192.73 0 1481 1193 1193 0.00%
crit 19.45% 0.19 0 1 2961.35 2961 2961 575.89 0 2961 576 576 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (22) 0.0% (0.1%) 1.0 0.00sec 6519 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 163  / 22 0.1% 90.0 1.29sec 72 55 Direct 90.0 61 121 72 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6518.88 6518.88 0.00% 55.35 55.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 72.66 59 83 60.73 43 69 60.73 59 63 4412 4412 0.00%
crit 19.27% 17.34 7 31 121.44 86 139 121.46 106 139 2106 2106 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (1019) 0.0% (6.0%) 6.1 52.65sec 49898 39695

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 1.2572 0.0000 0.00 0.00 0.00% 39694.98 39694.98

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.10
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1019 6.0% 6.1 52.52sec 49898 0 Direct 30.3 10028 0 10028 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 30.29 0.00 0.00 0.0000 0.0000 303349.03 303349.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.29 25 35 10027.79 2143 62852 9997.66 6946 13507 303349 303349 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34194.82
  • base_dd_max:34194.82
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.8 128.26sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.83
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 256.38sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [w]:1.83
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 256.51sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.85
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 1.2 174.89sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 6.93 0.00 4.2847 0.7213 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [r]:1.17
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [v]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.0 0.00sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.00
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
Rune of Power 5.9 50.48sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.94 0.00 0.00 0.00 1.2560 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.97
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.19sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [u]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.1 178.6 5.2sec 1.3sec 3.8sec 73.54% 0.00% 26.6 (26.7) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.04%
  • arcane_charge_2:16.28%
  • arcane_charge_3:16.70%
  • arcane_charge_4:21.52%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.4sec 128.4sec 14.6sec 13.92% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 134.1s
  • trigger_min/max:120.4s / 134.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.92%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 256.7sec 256.7sec 11.6sec 7.10% 23.57% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:246.2s / 263.2s
  • trigger_min/max:246.2s / 263.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.10%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.1 0.1 11.9sec 11.8sec 1.9sec 15.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.59%
  • clearcasting_2:0.12%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 256.8sec 256.8sec 19.1sec 11.64% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.2s / 262.9s
  • trigger_min/max:247.2s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.64%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 1.2 0.0 171.6sec 171.6sec 4.3sec 1.69% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.6s / 259.4s
  • trigger_min/max:90.6s / 259.4s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:1.69%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lead by Example 1.8 0.0 256.8sec 256.8sec 27.9sec 16.96% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.2s / 262.9s
  • trigger_min/max:247.2s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • lead_by_example_1:16.96%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.52%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.0 0.0 0.0sec 0.0sec 290.6sec 97.65% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:233.1s / 353.1s

Stack Uptimes

  • presence_of_mind_2:0.01%
  • presence_of_mind_3:97.64%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.8 0.0 35.2sec 35.2sec 11.8sec 34.74% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 55.3s
  • trigger_min/max:13.5s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.74%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 1 0.00% 0.00% 1.82%
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.82%
Arcane Barrage Arcane Charge 4 100.00% 96.36% 100.00%
Arcane Blast Arcane Charge 0 0.09% 0.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.80% 0.51% 6.45% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000177.405120.026239.962
Evocation141.5620.582349.896210.564126.789352.276
Rune of Power6.6420.03623.38540.80624.44155.982
Touch of the Magi5.4890.00021.84834.56923.13554.675
Arcane Power6.2400.37214.09017.9702.71525.538
Arcane Barrage2.7820.0029.580157.909126.258193.083
Arcane Orb3.6720.00010.48547.78134.16564.648
Deathborne34.3780.00081.62474.24358.72481.624
Presence of Mind6.8866.8766.8946.8866.8766.894

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 508.15 367966.06 63.65% 724.12 8385.59 2.23%
Evocation Mana 55.50 55782.09 9.65% 1005.04 0.00 0.00%
Mana Gem Mana 2.73 17300.34 2.99% 6337.14 0.00 0.00%
Arcane Barrage Mana 56.31 137098.97 23.71% 2434.66 5640.02 3.95%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1943.84 2048.20 14000.1 32332.4 312.3 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_blast Mana 0.0 1.2 1375.0 1355.7 2.0
arcane_explosion Mana 152.3 582664.9 3825.5 3826.0 4.1
arcane_orb Mana 12.9 5805.4 449.6 449.7 74.0
deathborne Mana 1.8 4591.0 2500.0 2503.2 0.0
touch_of_the_magi Mana 6.1 15195.7 2500.0 2499.5 20.0

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
Necrolord_Emeni Damage Per Second
Count 1121
Mean 17093.98
Minimum 15643.40
Maximum 18599.81
Spread ( max - min ) 2956.41
Range [ ( max - min ) / 2 * 100% ] 8.65%
Standard Deviation 554.6515
5th Percentile 16149.33
95th Percentile 17972.35
( 95th Percentile - 5th Percentile ) 1823.02
Mean Distribution
Standard Deviation 16.5660
95.00% Confidence Interval ( 17061.51 - 17126.45 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4045
0.1 Scale Factor Error with Delta=300 2627
0.05 Scale Factor Error with Delta=300 10505
0.01 Scale Factor Error with Delta=300 262618
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1121
Mean 4698.53
Minimum 4066.53
Maximum 5361.40
Spread ( max - min ) 1294.87
Range [ ( max - min ) / 2 * 100% ] 13.78%
Standard Deviation 214.4381
5th Percentile 4340.66
95th Percentile 5055.46
( 95th Percentile - 5th Percentile ) 714.81
Mean Distribution
Standard Deviation 6.4047
95.00% Confidence Interval ( 4685.98 - 4711.08 )
Normalized 95.00% Confidence Interval ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8002
0.1 Scale Factor Error with Delta=300 393
0.05 Scale Factor Error with Delta=300 1571
0.01 Scale Factor Error with Delta=300 39255
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1121
Mean 17093.98
Minimum 15643.40
Maximum 18599.81
Spread ( max - min ) 2956.41
Range [ ( max - min ) / 2 * 100% ] 8.65%
Damage
Necrolord_Emeni Damage
Count 1121
Mean 5079154.49
Minimum 3873260.03
Maximum 6211813.98
Spread ( max - min ) 2338553.94
Range [ ( max - min ) / 2 * 100% ] 23.02%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.85 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.10 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.83 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.97 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
o 12.91 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
p 152.31 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
q 56.31 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 1.17 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
u 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
v 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
w 1.83 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklvwqoqppnppqppppqppppmqpppupqoqppppqppppqppppqppppqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqppppqkmqppppqoqpppplqppppqpppupqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqpprjklwqoqppppqppppmqppppuqoqppppqppppqppppqoqppppqppppqk

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k touch_of_the_magi Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, deathborne, lead_by_example
0:02.313 aoe l arcane_power Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), deathborne, lead_by_example
0:02.313 shared_cds v potion Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
0:02.313 shared_cds w berserking Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:02.313 aoe q arcane_barrage Fluffy_Pillow 59652.8/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:03.227 aoe o arcane_orb Fluffy_Pillow 63346.1/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:04.141 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.057 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.971 aoe p arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.885 aoe n presence_of_mind Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.885 aoe p arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.799 aoe p arcane_explosion Fluffy_Pillow 61846.7/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:08.714 aoe q arcane_barrage Fluffy_Pillow 60506.4/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:09.628 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:10.542 aoe p arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:11.458 aoe p arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:12.374 aoe p arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:13.290 aoe q arcane_barrage Fluffy_Pillow 58012.8/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:14.205 aoe p arcane_explosion Fluffy_Pillow 61707.3/63371: 97% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:15.119 aoe p arcane_explosion Fluffy_Pillow 60365.7/63371: 95% mana bloodlust, arcane_charge, arcane_power, presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:16.127 aoe p arcane_explosion Fluffy_Pillow 59143.3/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:17.134 aoe p arcane_explosion Fluffy_Pillow 57919.6/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:18.140 aoe m rune_of_power Fluffy_Pillow 59194.6/63371: 93% mana bloodlust, arcane_charge(4), presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:19.147 aoe q arcane_barrage Fluffy_Pillow 60470.9/63371: 95% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:20.153 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:21.159 aoe p arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:22.166 aoe p arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.173 shared_cds u use_mana_gem Necrolord_Emeni 52199.1/63371: 82% mana bloodlust, arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.173 aoe p arcane_explosion Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.181 aoe q arcane_barrage Fluffy_Pillow 59813.8/63371: 94% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:25.188 aoe o arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:26.196 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:27.203 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:28.209 aoe p arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, clearcasting, presence_of_mind(3), rune_of_power, lead_by_example
0:29.214 aoe p arcane_explosion Fluffy_Pillow 60920.2/63371: 96% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example
0:30.220 aoe p arcane_explosion Fluffy_Pillow 57195.3/63371: 90% mana bloodlust, arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power, lead_by_example
0:31.227 aoe q arcane_barrage Fluffy_Pillow 58471.6/63371: 92% mana bloodlust, arcane_charge(4), presence_of_mind(3), lead_by_example
0:32.234 aoe p arcane_explosion Fluffy_Pillow 62282.7/63371: 98% mana bloodlust, presence_of_mind(3)
0:33.239 aoe p arcane_explosion Fluffy_Pillow 58556.5/63371: 92% mana bloodlust, arcane_charge, presence_of_mind(3)
0:34.246 aoe p arcane_explosion Fluffy_Pillow 54832.8/63371: 87% mana bloodlust, arcane_charge(2), clearcasting, presence_of_mind(3)
0:35.254 aoe p arcane_explosion Fluffy_Pillow 56110.4/63371: 89% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:36.261 aoe q arcane_barrage Fluffy_Pillow 52386.7/63371: 83% mana bloodlust, arcane_charge(4), presence_of_mind(3)
0:37.267 aoe p arcane_explosion Fluffy_Pillow 56196.5/63371: 89% mana bloodlust, presence_of_mind(3)
0:38.272 aoe p arcane_explosion Fluffy_Pillow 52470.3/63371: 83% mana bloodlust, arcane_charge, presence_of_mind(3)
0:39.277 aoe p arcane_explosion Fluffy_Pillow 48744.1/63371: 77% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:40.283 aoe p arcane_explosion Fluffy_Pillow 45019.1/63371: 71% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:41.290 aoe q arcane_barrage Fluffy_Pillow 41295.4/63371: 65% mana arcane_charge(4), presence_of_mind(3)
0:42.596 aoe p arcane_explosion Fluffy_Pillow 45485.5/63371: 72% mana presence_of_mind(3)
0:43.902 aoe p arcane_explosion Fluffy_Pillow 42140.8/63371: 66% mana arcane_charge, presence_of_mind(3)
0:45.209 aoe p arcane_explosion Fluffy_Pillow 38797.3/63371: 61% mana arcane_charge(2), presence_of_mind(3)
0:46.516 aoe p arcane_explosion Fluffy_Pillow 35453.8/63371: 56% mana arcane_charge(3), presence_of_mind(3)
0:47.822 aoe q arcane_barrage Fluffy_Pillow 32109.1/63371: 51% mana arcane_charge(4), presence_of_mind(3)
0:49.127 aoe o arcane_orb Fluffy_Pillow 36298.0/63371: 57% mana presence_of_mind(3)
0:50.434 aoe q arcane_barrage Fluffy_Pillow 37454.5/63371: 59% mana arcane_charge(4), presence_of_mind(3)
0:51.741 aoe p arcane_explosion Fluffy_Pillow 41645.9/63371: 66% mana presence_of_mind(3)
0:53.049 aoe p arcane_explosion Fluffy_Pillow 38303.7/63371: 60% mana arcane_charge, presence_of_mind(3)
0:54.355 aoe p arcane_explosion Fluffy_Pillow 34958.9/63371: 55% mana arcane_charge(2), presence_of_mind(3)
0:55.661 aoe p arcane_explosion Fluffy_Pillow 31614.2/63371: 50% mana arcane_charge(3), clearcasting, presence_of_mind(3)
0:56.967 aoe q arcane_barrage Fluffy_Pillow 33269.5/63371: 52% mana arcane_charge(4), presence_of_mind(3)
0:58.273 aoe p arcane_explosion Fluffy_Pillow 37459.6/63371: 59% mana presence_of_mind(3)
0:59.580 aoe p arcane_explosion Fluffy_Pillow 34116.1/63371: 54% mana arcane_charge, presence_of_mind(3)
1:00.886 aoe p arcane_explosion Fluffy_Pillow 30771.4/63371: 49% mana arcane_charge(2), presence_of_mind(3)
1:02.193 aoe p arcane_explosion Fluffy_Pillow 27427.9/63371: 43% mana arcane_charge(3), presence_of_mind(3)
1:03.500 aoe q arcane_barrage Fluffy_Pillow 24084.4/63371: 38% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:04.806 aoe k touch_of_the_magi Fluffy_Pillow 28274.5/63371: 45% mana clearcasting, presence_of_mind(3)
1:06.113 aoe m rune_of_power Fluffy_Pillow 27431.1/63371: 43% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:07.419 aoe q arcane_barrage Fluffy_Pillow 29086.3/63371: 46% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
1:08.729 aoe p arcane_explosion Fluffy_Pillow 33281.5/63371: 53% mana clearcasting, presence_of_mind(3), rune_of_power
1:10.034 aoe p arcane_explosion Fluffy_Pillow 34935.5/63371: 55% mana arcane_charge, presence_of_mind(3), rune_of_power
1:11.341 aoe p arcane_explosion Fluffy_Pillow 31592.0/63371: 50% mana arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power
1:12.646 aoe p arcane_explosion Fluffy_Pillow 33246.0/63371: 52% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:13.951 aoe q arcane_barrage Fluffy_Pillow 29900.0/63371: 47% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
1:15.257 aoe o arcane_orb Fluffy_Pillow 34090.2/63371: 54% mana clearcasting, presence_of_mind(3), rune_of_power
1:16.564 aoe q arcane_barrage Fluffy_Pillow 35246.7/63371: 56% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
1:17.871 aoe p arcane_explosion Fluffy_Pillow 39438.1/63371: 62% mana clearcasting, presence_of_mind(3), rune_of_power
1:19.178 aoe p arcane_explosion Fluffy_Pillow 41094.6/63371: 65% mana arcane_charge, presence_of_mind(3), rune_of_power
1:20.484 aoe p arcane_explosion Fluffy_Pillow 37749.9/63371: 60% mana arcane_charge(2), presence_of_mind(3)
1:21.790 aoe p arcane_explosion Fluffy_Pillow 34405.1/63371: 54% mana arcane_charge(3), presence_of_mind(3)
1:23.098 aoe q arcane_barrage Fluffy_Pillow 31062.9/63371: 49% mana arcane_charge(4), presence_of_mind(3)
1:24.405 aoe p arcane_explosion Fluffy_Pillow 35254.3/63371: 56% mana presence_of_mind(3)
1:25.711 aoe p arcane_explosion Fluffy_Pillow 31909.6/63371: 50% mana arcane_charge, presence_of_mind(3)
1:27.016 aoe p arcane_explosion Fluffy_Pillow 28563.6/63371: 45% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:28.323 aoe p arcane_explosion Fluffy_Pillow 30220.1/63371: 48% mana arcane_charge(3), presence_of_mind(3)
1:29.628 aoe q arcane_barrage Fluffy_Pillow 26874.1/63371: 42% mana arcane_charge(4), presence_of_mind(3)
1:30.935 aoe p arcane_explosion Fluffy_Pillow 31065.5/63371: 49% mana presence_of_mind(3)
1:32.241 aoe p arcane_explosion Fluffy_Pillow 27720.7/63371: 44% mana arcane_charge, presence_of_mind(3)
1:33.546 aoe p arcane_explosion Fluffy_Pillow 24374.7/63371: 38% mana arcane_charge(2), presence_of_mind(3)
1:34.851 aoe p arcane_explosion Fluffy_Pillow 21028.7/63371: 33% mana arcane_charge(3), clearcasting, presence_of_mind(3)
1:36.158 aoe q arcane_barrage Fluffy_Pillow 22685.3/63371: 36% mana arcane_charge(4), presence_of_mind(3)
1:37.465 aoe o arcane_orb Fluffy_Pillow 26876.6/63371: 42% mana presence_of_mind(3)
1:38.771 aoe q arcane_barrage Fluffy_Pillow 28031.9/63371: 44% mana arcane_charge(4), presence_of_mind(3)
1:40.075 aoe p arcane_explosion Fluffy_Pillow 32219.5/63371: 51% mana presence_of_mind(3)
1:41.382 aoe p arcane_explosion Fluffy_Pillow 28876.0/63371: 46% mana arcane_charge, clearcasting, presence_of_mind(3)
1:42.688 aoe p arcane_explosion Fluffy_Pillow 30531.3/63371: 48% mana arcane_charge(2), presence_of_mind(3)
1:43.994 aoe p arcane_explosion Fluffy_Pillow 27186.5/63371: 43% mana arcane_charge(3), clearcasting, presence_of_mind(3)
1:45.300 aoe q arcane_barrage Fluffy_Pillow 28841.8/63371: 46% mana arcane_charge(4), presence_of_mind(3)
1:46.607 aoe p arcane_explosion Fluffy_Pillow 33033.2/63371: 52% mana presence_of_mind(3)
1:47.912 aoe p arcane_explosion Fluffy_Pillow 29687.2/63371: 47% mana arcane_charge, presence_of_mind(3)
1:49.218 aoe p arcane_explosion Fluffy_Pillow 26342.4/63371: 42% mana arcane_charge(2), presence_of_mind(3)
1:50.526 aoe p arcane_explosion Fluffy_Pillow 23000.2/63371: 36% mana arcane_charge(3), clearcasting, presence_of_mind(3)
1:51.833 aoe q arcane_barrage Fluffy_Pillow 24656.8/63371: 39% mana arcane_charge(4), presence_of_mind(3)
1:53.139 aoe k touch_of_the_magi Fluffy_Pillow 28846.9/63371: 46% mana presence_of_mind(3)
1:54.447 aoe m rune_of_power Fluffy_Pillow 28004.7/63371: 44% mana arcane_charge(4), presence_of_mind(3)
1:55.752 aoe q arcane_barrage Fluffy_Pillow 29658.7/63371: 47% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:57.058 aoe p arcane_explosion Fluffy_Pillow 33848.8/63371: 53% mana presence_of_mind(3), rune_of_power
1:58.366 aoe p arcane_explosion Fluffy_Pillow 30506.6/63371: 48% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
1:59.672 aoe p arcane_explosion Fluffy_Pillow 32161.9/63371: 51% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:00.976 aoe p arcane_explosion Fluffy_Pillow 28814.6/63371: 45% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:02.283 aoe q arcane_barrage Fluffy_Pillow 25471.1/63371: 40% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:03.590 aoe o arcane_orb Fluffy_Pillow 29662.5/63371: 47% mana presence_of_mind(3), rune_of_power
2:04.896 aoe q arcane_barrage Fluffy_Pillow 30817.8/63371: 49% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:06.202 aoe p arcane_explosion Fluffy_Pillow 35007.9/63371: 55% mana presence_of_mind(3), rune_of_power
2:07.508 aoe p arcane_explosion Fluffy_Pillow 31663.1/63371: 50% mana arcane_charge, presence_of_mind(3), rune_of_power
2:08.814 aoe p arcane_explosion Fluffy_Pillow 28318.4/63371: 45% mana arcane_charge(2), clearcasting, presence_of_mind(3)
2:10.120 aoe p arcane_explosion Fluffy_Pillow 29973.7/63371: 47% mana arcane_charge(3), presence_of_mind(3)
2:11.427 aoe l arcane_power Fluffy_Pillow 26630.2/63371: 42% mana arcane_charge(4), presence_of_mind(3)
2:11.427 aoe q arcane_barrage Fluffy_Pillow 26630.2/63371: 42% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:12.734 aoe p arcane_explosion Fluffy_Pillow 30821.6/63371: 49% mana arcane_power, presence_of_mind(3), rune_of_power
2:14.039 aoe p arcane_explosion Fluffy_Pillow 29975.6/63371: 47% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:15.346 aoe p arcane_explosion Fluffy_Pillow 29132.1/63371: 46% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:16.653 aoe p arcane_explosion Fluffy_Pillow 28288.6/63371: 45% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:17.959 aoe q arcane_barrage Fluffy_Pillow 27443.9/63371: 43% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:19.265 aoe p arcane_explosion Fluffy_Pillow 31634.0/63371: 50% mana arcane_power, presence_of_mind(3), rune_of_power
2:20.571 aoe p arcane_explosion Fluffy_Pillow 30789.3/63371: 49% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:21.877 aoe p arcane_explosion Fluffy_Pillow 29944.5/63371: 47% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:23.182 shared_cds u use_mana_gem Necrolord_Emeni 29098.5/63371: 46% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:23.182 aoe p arcane_explosion Fluffy_Pillow 35435.7/63371: 56% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:24.492 aoe q arcane_barrage Fluffy_Pillow 34596.0/63371: 55% mana arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3)
2:25.798 aoe o arcane_orb Fluffy_Pillow 38786.1/63371: 61% mana arcane_power, clearcasting, presence_of_mind(3)
2:27.103 aoe q arcane_barrage Fluffy_Pillow 40190.1/63371: 63% mana arcane_charge(4), clearcasting, presence_of_mind(3)
2:28.408 aoe p arcane_explosion Fluffy_Pillow 44379.0/63371: 70% mana clearcasting, presence_of_mind(3)
2:29.714 aoe p arcane_explosion Fluffy_Pillow 46034.2/63371: 73% mana arcane_charge, presence_of_mind(3)
2:31.020 aoe p arcane_explosion Fluffy_Pillow 42689.5/63371: 67% mana arcane_charge(2), presence_of_mind(3)
2:32.328 aoe p arcane_explosion Fluffy_Pillow 39347.3/63371: 62% mana arcane_charge(3), presence_of_mind(3)
2:33.634 aoe q arcane_barrage Fluffy_Pillow 36002.5/63371: 57% mana arcane_charge(4), presence_of_mind(3)
2:34.939 aoe p arcane_explosion Fluffy_Pillow 40191.4/63371: 63% mana presence_of_mind(3)
2:36.247 aoe p arcane_explosion Fluffy_Pillow 36849.2/63371: 58% mana arcane_charge, presence_of_mind(3)
2:37.553 aoe p arcane_explosion Fluffy_Pillow 33504.5/63371: 53% mana arcane_charge(2), presence_of_mind(3)
2:38.856 aoe p arcane_explosion Fluffy_Pillow 30155.9/63371: 48% mana arcane_charge(3), clearcasting, presence_of_mind(3)
2:40.161 aoe q arcane_barrage Fluffy_Pillow 31809.9/63371: 50% mana arcane_charge(4), presence_of_mind(3)
2:41.466 aoe k touch_of_the_magi Fluffy_Pillow 35998.8/63371: 57% mana presence_of_mind(3)
2:42.774 aoe m rune_of_power Fluffy_Pillow 35156.6/63371: 55% mana arcane_charge(4), presence_of_mind(3)
2:44.081 aoe q arcane_barrage Fluffy_Pillow 36813.1/63371: 58% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:45.388 aoe p arcane_explosion Fluffy_Pillow 41004.5/63371: 65% mana presence_of_mind(3), rune_of_power
2:46.693 aoe p arcane_explosion Fluffy_Pillow 37658.5/63371: 59% mana arcane_charge, presence_of_mind(3), rune_of_power
2:48.000 aoe p arcane_explosion Fluffy_Pillow 34315.0/63371: 54% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:49.307 aoe p arcane_explosion Fluffy_Pillow 30971.5/63371: 49% mana arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power
2:50.613 aoe q arcane_barrage Fluffy_Pillow 32626.8/63371: 51% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:51.919 aoe o arcane_orb Fluffy_Pillow 36816.9/63371: 58% mana presence_of_mind(3), rune_of_power
2:53.224 aoe q arcane_barrage Fluffy_Pillow 37970.9/63371: 60% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:54.528 aoe p arcane_explosion Fluffy_Pillow 42158.5/63371: 67% mana presence_of_mind(3), rune_of_power
2:55.836 aoe p arcane_explosion Fluffy_Pillow 38816.3/63371: 61% mana arcane_charge, presence_of_mind(3), rune_of_power
2:57.143 aoe p arcane_explosion Fluffy_Pillow 35472.8/63371: 56% mana arcane_charge(2), presence_of_mind(3)
2:58.450 aoe p arcane_explosion Fluffy_Pillow 32129.3/63371: 51% mana arcane_charge(3), presence_of_mind(3)
2:59.757 aoe q arcane_barrage Fluffy_Pillow 28785.9/63371: 45% mana arcane_charge(4), presence_of_mind(3)
3:01.063 aoe p arcane_explosion Fluffy_Pillow 32976.0/63371: 52% mana presence_of_mind(3)
3:02.370 aoe p arcane_explosion Fluffy_Pillow 29632.5/63371: 47% mana arcane_charge, clearcasting, presence_of_mind(3)
3:03.676 aoe p arcane_explosion Fluffy_Pillow 31287.8/63371: 49% mana arcane_charge(2), presence_of_mind(3)
3:04.983 aoe p arcane_explosion Fluffy_Pillow 27944.3/63371: 44% mana arcane_charge(3), presence_of_mind(3)
3:06.289 aoe q arcane_barrage Fluffy_Pillow 24599.6/63371: 39% mana arcane_charge(4), presence_of_mind(3)
3:07.595 aoe p arcane_explosion Fluffy_Pillow 28789.7/63371: 45% mana presence_of_mind(3)
3:08.903 aoe p arcane_explosion Fluffy_Pillow 25447.5/63371: 40% mana arcane_charge, presence_of_mind(3)
3:10.209 aoe p arcane_explosion Fluffy_Pillow 22102.7/63371: 35% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:11.516 aoe p arcane_explosion Fluffy_Pillow 23759.3/63371: 37% mana arcane_charge(3), presence_of_mind(3)
3:12.822 aoe q arcane_barrage Fluffy_Pillow 20414.5/63371: 32% mana arcane_charge(4), clearcasting, presence_of_mind(3)
3:14.129 aoe o arcane_orb Fluffy_Pillow 24605.9/63371: 39% mana clearcasting, presence_of_mind(3)
3:15.435 aoe q arcane_barrage Fluffy_Pillow 25761.2/63371: 41% mana arcane_charge(4), clearcasting, presence_of_mind(3)
3:16.740 aoe p arcane_explosion Fluffy_Pillow 29950.0/63371: 47% mana clearcasting, presence_of_mind(3)
3:18.047 aoe p arcane_explosion Fluffy_Pillow 31606.6/63371: 50% mana arcane_charge, presence_of_mind(3)
3:19.354 aoe p arcane_explosion Fluffy_Pillow 28263.1/63371: 45% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:20.660 aoe p arcane_explosion Fluffy_Pillow 29918.4/63371: 47% mana arcane_charge(3), presence_of_mind(3)
3:21.966 aoe q arcane_barrage Fluffy_Pillow 26573.6/63371: 42% mana arcane_charge(4), presence_of_mind(3)
3:23.273 aoe p arcane_explosion Fluffy_Pillow 30765.0/63371: 49% mana presence_of_mind(3)
3:24.582 aoe p arcane_explosion Fluffy_Pillow 27424.1/63371: 43% mana arcane_charge, presence_of_mind(3)
3:25.889 aoe p arcane_explosion Fluffy_Pillow 24080.6/63371: 38% mana arcane_charge(2), presence_of_mind(3)
3:27.196 aoe p arcane_explosion Fluffy_Pillow 20737.1/63371: 33% mana arcane_charge(3), presence_of_mind(3)
3:28.501 aoe q arcane_barrage Fluffy_Pillow 17391.1/63371: 27% mana arcane_charge(4), presence_of_mind(3)
3:29.806 aoe k touch_of_the_magi Fluffy_Pillow 21580.0/63371: 34% mana presence_of_mind(3)
3:31.113 aoe m rune_of_power Fluffy_Pillow 20736.5/63371: 33% mana arcane_charge(4), presence_of_mind(3)
3:32.420 aoe q arcane_barrage Fluffy_Pillow 22393.0/63371: 35% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:33.728 aoe p arcane_explosion Fluffy_Pillow 26585.7/63371: 42% mana presence_of_mind(3), rune_of_power
3:35.035 aoe p arcane_explosion Fluffy_Pillow 23242.2/63371: 37% mana arcane_charge, presence_of_mind(3), rune_of_power
3:36.343 aoe p arcane_explosion Fluffy_Pillow 19900.0/63371: 31% mana arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power
3:37.650 aoe p arcane_explosion Fluffy_Pillow 21556.5/63371: 34% mana arcane_charge(3), presence_of_mind(3), rune_of_power
3:38.958 aoe q arcane_barrage Fluffy_Pillow 18214.3/63371: 29% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:40.264 aoe o arcane_orb Fluffy_Pillow 22404.5/63371: 35% mana presence_of_mind(3), rune_of_power
3:41.570 aoe q arcane_barrage Fluffy_Pillow 23559.7/63371: 37% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:42.877 aoe p arcane_explosion Fluffy_Pillow 27751.1/63371: 44% mana presence_of_mind(3), rune_of_power
3:44.183 aoe p arcane_explosion Fluffy_Pillow 24406.4/63371: 39% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
3:45.487 aoe p arcane_explosion Fluffy_Pillow 26059.1/63371: 41% mana arcane_charge(2), presence_of_mind(3)
3:46.794 aoe p arcane_explosion Fluffy_Pillow 22715.6/63371: 36% mana arcane_charge(3), presence_of_mind(3)
3:48.102 aoe q arcane_barrage Fluffy_Pillow 19373.4/63371: 31% mana arcane_charge(4), presence_of_mind(3)
3:49.409 aoe p arcane_explosion Fluffy_Pillow 23564.8/63371: 37% mana presence_of_mind(3)
3:50.715 aoe p arcane_explosion Fluffy_Pillow 20220.1/63371: 32% mana arcane_charge, presence_of_mind(3)
3:52.024 aoe p arcane_explosion Fluffy_Pillow 16879.1/63371: 27% mana arcane_charge(2), presence_of_mind(3)
3:53.329 aoe p arcane_explosion Fluffy_Pillow 13533.1/63371: 21% mana arcane_charge(3), presence_of_mind(3)
3:54.636 aoe q arcane_barrage Fluffy_Pillow 10189.7/63371: 16% mana arcane_charge(4), presence_of_mind(3)
3:55.946 aoe p arcane_explosion Fluffy_Pillow 14384.8/63371: 23% mana presence_of_mind(3)
3:57.254 aoe p arcane_explosion Fluffy_Pillow 11042.6/63371: 17% mana arcane_charge, presence_of_mind(3)
3:58.560 aoe p arcane_explosion Fluffy_Pillow 7697.9/63371: 12% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:59.866 aoe p arcane_explosion Fluffy_Pillow 9353.2/63371: 15% mana arcane_charge(3), presence_of_mind(3)
4:01.172 aoe q arcane_barrage Fluffy_Pillow 6008.4/63371: 9% mana arcane_charge(4), presence_of_mind(3)
4:02.479 aoe o arcane_orb Fluffy_Pillow 10199.8/63371: 16% mana presence_of_mind(3)
4:03.786 aoe q arcane_barrage Fluffy_Pillow 11356.3/63371: 18% mana arcane_charge(4), presence_of_mind(3)
4:05.092 aoe p arcane_explosion Fluffy_Pillow 15546.5/63371: 25% mana presence_of_mind(3)
4:06.399 aoe p arcane_explosion Fluffy_Pillow 12203.0/63371: 19% mana arcane_charge, clearcasting, presence_of_mind(3)
4:07.707 aoe p arcane_explosion Fluffy_Pillow 13860.8/63371: 22% mana arcane_charge(2), presence_of_mind(3)
4:09.013 aoe p arcane_explosion Fluffy_Pillow 10516.0/63371: 17% mana arcane_charge(3), presence_of_mind(3)
4:10.317 aoe q arcane_barrage Fluffy_Pillow 7168.8/63371: 11% mana arcane_charge(4), presence_of_mind(3)
4:11.623 aoe p arcane_explosion Fluffy_Pillow 11358.9/63371: 18% mana presence_of_mind(3)
4:12.929 aoe p arcane_explosion Fluffy_Pillow 8014.2/63371: 13% mana arcane_charge, presence_of_mind(3)
4:14.236 aoe r evocation Necrolord_Emeni 4670.7/63371: 7% mana arcane_charge(2), presence_of_mind(3)
4:18.579 aoe j deathborne Fluffy_Pillow 58514.1/63371: 92% mana arcane_charge(2), presence_of_mind(3)
4:19.886 aoe k touch_of_the_magi Fluffy_Pillow 57670.6/63371: 91% mana arcane_charge(2), presence_of_mind(3), deathborne, lead_by_example
4:21.192 aoe l arcane_power Fluffy_Pillow 56825.9/63371: 90% mana arcane_charge(4), presence_of_mind(3), deathborne, lead_by_example
4:21.192 shared_cds w berserking Fluffy_Pillow 56825.9/63371: 90% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:21.192 aoe q arcane_barrage Fluffy_Pillow 56825.9/63371: 90% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:22.381 aoe o arcane_orb Fluffy_Pillow 60867.7/63371: 96% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:23.666 aoe q arcane_barrage Fluffy_Pillow 62246.3/63371: 98% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:24.855 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:26.044 aoe p arcane_explosion Fluffy_Pillow 62378.4/63371: 98% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:27.233 aoe p arcane_explosion Fluffy_Pillow 61385.4/63371: 97% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:28.421 aoe p arcane_explosion Fluffy_Pillow 60391.1/63371: 95% mana berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:29.611 aoe q arcane_barrage Fluffy_Pillow 59399.3/63371: 94% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:30.799 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:31.987 aoe p arcane_explosion Fluffy_Pillow 62377.1/63371: 98% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:33.174 aoe p arcane_explosion Fluffy_Pillow 61381.6/63371: 97% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:34.363 aoe p arcane_explosion Fluffy_Pillow 60388.5/63371: 95% mana arcane_charge(3), arcane_power, presence_of_mind(3), deathborne, lead_by_example
4:35.670 aoe m rune_of_power Fluffy_Pillow 59545.1/63371: 94% mana arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), deathborne, lead_by_example
4:36.976 aoe q arcane_barrage Fluffy_Pillow 61200.3/63371: 97% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:38.281 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:39.587 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:40.894 aoe p arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example
4:42.201 aoe p arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(3), presence_of_mind(3), rune_of_power, lead_by_example
4:43.507 shared_cds u use_mana_gem Necrolord_Emeni 53339.7/63371: 84% mana arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example
4:43.507 aoe q arcane_barrage Fluffy_Pillow 59676.9/63371: 94% mana arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example
4:44.814 aoe o arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power, lead_by_example
4:46.120 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example
4:47.426 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power, lead_by_example
4:48.733 aoe p arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, presence_of_mind(3), rune_of_power, lead_by_example
4:50.039 aoe p arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), presence_of_mind(3)
4:51.345 aoe p arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), presence_of_mind(3)
4:52.651 aoe q arcane_barrage Fluffy_Pillow 49993.7/63371: 79% mana arcane_charge(4), presence_of_mind(3)
4:53.959 aoe p arcane_explosion Fluffy_Pillow 54186.4/63371: 86% mana presence_of_mind(3)
4:55.265 aoe p arcane_explosion Fluffy_Pillow 50841.7/63371: 80% mana arcane_charge, presence_of_mind(3)
4:56.573 aoe p arcane_explosion Fluffy_Pillow 47499.5/63371: 75% mana arcane_charge(2), presence_of_mind(3)
4:57.880 aoe p arcane_explosion Fluffy_Pillow 44156.0/63371: 70% mana arcane_charge(3), presence_of_mind(3)
4:59.185 aoe q arcane_barrage Fluffy_Pillow 40810.0/63371: 64% mana arcane_charge(4), presence_of_mind(3)
5:00.492 aoe p arcane_explosion Fluffy_Pillow 45001.4/63371: 71% mana presence_of_mind(3)
5:01.801 aoe p arcane_explosion Fluffy_Pillow 41660.4/63371: 66% mana arcane_charge, presence_of_mind(3)
5:03.107 aoe p arcane_explosion Fluffy_Pillow 38315.7/63371: 60% mana arcane_charge(2), presence_of_mind(3)
5:04.415 aoe p arcane_explosion Fluffy_Pillow 34973.5/63371: 55% mana arcane_charge(3), presence_of_mind(3)
5:05.721 aoe q arcane_barrage Fluffy_Pillow 31628.7/63371: 50% mana arcane_charge(4), presence_of_mind(3)
5:07.028 aoe o arcane_orb Fluffy_Pillow 35820.1/63371: 57% mana presence_of_mind(3)
5:08.335 aoe q arcane_barrage Fluffy_Pillow 36976.7/63371: 58% mana arcane_charge(4), presence_of_mind(3)
5:09.642 aoe p arcane_explosion Fluffy_Pillow 41168.1/63371: 65% mana presence_of_mind(3)
5:10.948 aoe p arcane_explosion Fluffy_Pillow 37823.3/63371: 60% mana arcane_charge, presence_of_mind(3)
5:12.257 aoe p arcane_explosion Fluffy_Pillow 34482.4/63371: 54% mana arcane_charge(2), presence_of_mind(3)
5:13.563 aoe p arcane_explosion Fluffy_Pillow 31137.6/63371: 49% mana arcane_charge(3), presence_of_mind(3)
5:14.870 aoe q arcane_barrage Fluffy_Pillow 27794.2/63371: 44% mana arcane_charge(4), presence_of_mind(3)
5:16.176 aoe p arcane_explosion Fluffy_Pillow 31984.3/63371: 50% mana presence_of_mind(3)
5:17.483 aoe p arcane_explosion Fluffy_Pillow 28640.8/63371: 45% mana arcane_charge, presence_of_mind(3)
5:18.788 aoe p arcane_explosion Fluffy_Pillow 25294.8/63371: 40% mana arcane_charge(2), presence_of_mind(3)
5:20.095 aoe p arcane_explosion Fluffy_Pillow 21951.3/63371: 35% mana arcane_charge(3), presence_of_mind(3)
5:21.401 aoe q arcane_barrage Fluffy_Pillow 18606.6/63371: 29% mana arcane_charge(4), presence_of_mind(3)
5:22.709 aoe k touch_of_the_magi Fluffy_Pillow 22799.3/63371: 36% mana presence_of_mind(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream : 16908 dps, 4606 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16907.8 16907.8 19.2 / 0.113% 1243.1 / 7.4% 8.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
1888.5 1783.1 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 16908
Arcane Barrage 5633 33.3% 53.9 5.54sec 31061 25101 Direct 269.0 5218 10418 6222 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 53.88 269.03 0.00 0.00 1.2374 0.0000 1673559.93 1673559.93 0.00% 25101.39 25101.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 217.06 161 277 5218.10 2082 25140 5217.05 4776 5615 1132121 1132121 0.00%
crit 19.32% 51.97 27 82 10417.62 4164 50280 10423.41 7494 14351 541439 541439 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:53.89
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 476 2.8% 40.9 6.92sec 3453 0 Direct 204.7 578 1158 691 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.94 204.71 0.00 0.00 0.0000 0.0000 141357.99 141357.99 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 165.06 121 212 578.43 443 664 578.30 559 602 95458 95458 0.00%
crit 19.37% 39.65 16 63 1157.71 886 1329 1157.32 1052 1264 45900 45900 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7458 44.1% 141.2 2.08sec 15692 12616 Direct 706.2 2629 5264 3139 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 141.24 706.22 0.00 0.00 1.2438 0.0000 2216347.18 2216347.18 0.00% 12616.18 12616.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 569.76 441 702 2629.10 1958 4112 2629.58 2547 2705 1497988 1497988 0.00%
crit 19.32% 136.46 90 197 5263.59 3916 8223 5263.98 4857 5639 718359 718359 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:141.26
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1449) 0.0% (8.6%) 13.3 22.93sec 32291 26391

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.33 0.00 0.00 0.00 1.2236 0.0000 0.00 0.00 0.00% 26390.83 26390.83

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.33
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1449 8.6% 66.5 22.93sec 6472 0 Direct 66.5 5425 10788 6470 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.51 66.51 0.00 0.00 0.0000 0.0000 430408.13 430408.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.49% 53.54 34 71 5424.84 3869 8126 5426.75 4972 5804 290523 290523 0.00%
crit 19.51% 12.97 4 27 10787.99 7739 16251 10787.06 8083 13543 139885 139885 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (84) 0.0% (0.5%) 18.4 8.92sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.36 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 84 0.5% 18.4 8.92sec 1386 0 Direct 18.4 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.36 18.36 0.00 0.00 0.0000 0.0000 25439.92 25439.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 14.85 4 30 1163.53 1164 1164 1163.53 1164 1164 17284 17284 0.00%
crit 19.09% 3.50 0 11 2327.06 2327 2327 2246.10 0 2327 8156 8156 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1762 18.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1760.70 1760.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.09% 0.81 0 1 1480.68 1481 1481 1200.66 0 1481 1201 1201 0.00%
crit 18.91% 0.19 0 1 2961.35 2961 2961 560.04 0 2961 560 560 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5790 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5790.10 5790.10 0.00% 49.16 49.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 72.65 58 84 53.92 43 60 53.92 53 55 3917 3917 0.00%
crit 19.28% 17.35 6 32 107.95 86 120 107.92 96 119 1873 1873 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 658 3.9% 6.0 48.46sec 32572 9119 Periodic 119.6 1372 2745 1636 19.3% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 0.00 23.92 119.62 3.5720 0.8346 195750.13 195750.13 0.00% 9118.65 9118.65
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.75% 96.59 68 126 1372.31 1372 1372 1372.31 1372 1372 132551 132551 0.00%
crit 19.25% 23.03 7 41 2744.61 2745 2745 2744.61 2745 2745 63200 63200 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.01
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1124) 0.0% (6.6%) 6.6 48.86sec 50788 38873

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.57 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 38873.49 38873.49

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.60
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1124 6.6% 6.6 48.73sec 50788 0 Direct 32.7 10214 0 10214 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.57 32.69 0.00 0.00 0.0000 0.0000 333495.70 333495.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.69 25 40 10214.27 2560 48513 10223.59 8356 12545 333496 333496 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11261.83
  • base_dd_max:11261.83
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.5 97.22sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.53
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.77sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.24 0.00 1.44 0.00 4.2522 0.7207 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.24
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.49sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.45
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 47.06sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 0.00 0.00 0.00 1.2597 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.43
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.89sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.78
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 54.6 173.0 5.5sec 1.3sec 4.1sec 75.65% 0.00% 28.7 (29.8) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.8s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:18.19%
  • arcane_charge_2:15.58%
  • arcane_charge_3:14.61%
  • arcane_charge_4:27.27%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.5 0.0 97.2sec 97.2sec 14.7sec 17.47% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.47%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.18% 23.73% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.3s
  • trigger_min/max:192.7s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.18%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.3 0.3 12.9sec 12.8sec 2.3sec 16.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.52%
  • clearcasting_2:0.40%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.3sec 0.35% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:0.36%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.2sec 11.15% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.15%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.1sec 31.1sec 11.8sec 39.35% 0.00% 0.0 (0.0) 9.5

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.9s
  • trigger_min/max:14.4s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.35%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.65% 0.76% 6.04% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000201.405144.026263.962
Evocation232.99593.204349.973284.837162.026359.851
Rune of Power13.4190.06131.55989.58671.476108.964
Touch of the Magi12.2140.00021.71583.27167.990106.310
Arcane Power1.2260.0056.0794.3261.9649.218
Arcane Barrage3.0320.00212.158164.672132.851200.831
Arcane Orb4.2580.00011.63157.41937.21777.163
Shifting Power7.8850.00030.23747.60642.71956.998

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 686.08 369215.74 69.62% 538.16 7221.65 1.92%
Evocation Mana 11.43 11484.51 2.17% 1004.61 0.00 0.00%
Mana Gem Mana 2.78 17590.17 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 53.89 132065.97 24.90% 2450.46 4548.79 3.33%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1783.15 1888.50 11777.5 32038.6 1251.4 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 141.3 523449.9 3705.5 3706.0 4.2
arcane_orb Mana 13.3 5799.9 435.2 435.1 74.2
shifting_power Mana 6.0 15024.2 2500.0 2499.9 13.0
touch_of_the_magi Mana 6.6 16431.4 2500.0 2502.3 20.3

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
NightFae_Dream Damage Per Second
Count 1121
Mean 16907.83
Minimum 16005.52
Maximum 17951.88
Spread ( max - min ) 1946.37
Range [ ( max - min ) / 2 * 100% ] 5.76%
Standard Deviation 327.2033
5th Percentile 16369.86
95th Percentile 17449.08
( 95th Percentile - 5th Percentile ) 1079.22
Mean Distribution
Standard Deviation 9.7727
95.00% Confidence Interval ( 16888.67 - 16926.98 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1439
0.1 Scale Factor Error with Delta=300 914
0.05 Scale Factor Error with Delta=300 3656
0.01 Scale Factor Error with Delta=300 91395
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1121
Mean 4606.00
Minimum 4148.85
Maximum 5179.28
Spread ( max - min ) 1030.43
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 154.0514
5th Percentile 4358.36
95th Percentile 4865.66
( 95th Percentile - 5th Percentile ) 507.29
Mean Distribution
Standard Deviation 4.6011
95.00% Confidence Interval ( 4596.98 - 4615.02 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4298
0.1 Scale Factor Error with Delta=300 203
0.05 Scale Factor Error with Delta=300 811
0.01 Scale Factor Error with Delta=300 20259
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1121
Mean 16907.83
Minimum 16005.52
Maximum 17951.88
Spread ( max - min ) 1946.37
Range [ ( max - min ) / 2 * 100% ] 5.76%
Damage
NightFae_Dream Damage
Count 1121
Mean 5018119.67
Minimum 4007779.17
Maximum 6110422.01
Spread ( max - min ) 2102642.84
Range [ ( max - min ) / 2 * 100% ] 20.95%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.60 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.53 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.43 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.33 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.01 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 141.26 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 53.89 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.24 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.78 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.45 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooporooopjlpoooopmpoooopoooonpmpoooopooqjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpoooorpoooonpmpoooopoooopjkpoooopmspoooolpoooopoooon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.136 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.049 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.962 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.877 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.791 aoe o arcane_explosion Fluffy_Pillow 59346.7/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.706 aoe p arcane_barrage Fluffy_Pillow 58006.4/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.622 aoe o arcane_explosion Fluffy_Pillow 61702.2/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.536 aoe o arcane_explosion Fluffy_Pillow 60360.7/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.451 aoe o arcane_explosion Fluffy_Pillow 59020.4/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:11.365 aoe o arcane_explosion Fluffy_Pillow 60178.8/63371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.281 aoe p arcane_barrage Fluffy_Pillow 58839.8/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.196 aoe o arcane_explosion Fluffy_Pillow 62534.3/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.112 aoe o arcane_explosion Fluffy_Pillow 61195.3/63371: 97% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.118 aoe o arcane_explosion Fluffy_Pillow 59970.3/63371: 95% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.126 aoe o arcane_explosion Fluffy_Pillow 58747.9/63371: 93% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, potion_of_deathly_fixation
0:17.133 aoe l rune_of_power Fluffy_Pillow 60024.2/63371: 95% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.140 aoe p arcane_barrage Fluffy_Pillow 61300.5/63371: 97% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.145 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.151 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.156 aoe o arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:22.163 aoe o arcane_explosion Fluffy_Pillow 57196.5/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.168 shared_cds r use_mana_gem NightFae_Dream 53470.3/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.168 aoe p arcane_barrage Fluffy_Pillow 59807.4/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.174 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.181 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.188 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.194 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:28.202 aoe o arcane_explosion Fluffy_Pillow 60924.0/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power
0:29.207 aoe o arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.214 aoe n shifting_power Fluffy_Pillow 53474.1/63371: 84% mana bloodlust, arcane_charge(4)
0:33.166 aoe p arcane_barrage Fluffy_Pillow 54715.5/63371: 86% mana bloodlust, arcane_charge(4)
0:34.173 aoe m arcane_orb Fluffy_Pillow 58526.7/63371: 92% mana bloodlust
0:35.179 aoe p arcane_barrage Fluffy_Pillow 59301.7/63371: 94% mana bloodlust, arcane_charge(4)
0:36.186 aoe o arcane_explosion Fluffy_Pillow 63112.9/63371: 100% mana bloodlust
0:37.194 aoe o arcane_explosion Fluffy_Pillow 59390.5/63371: 94% mana bloodlust, arcane_charge
0:38.201 aoe o arcane_explosion Fluffy_Pillow 55666.8/63371: 88% mana bloodlust, arcane_charge(2), clearcasting
0:39.207 aoe o arcane_explosion Fluffy_Pillow 56941.8/63371: 90% mana bloodlust, arcane_charge(3)
0:40.214 aoe p arcane_barrage Fluffy_Pillow 53218.1/63371: 84% mana bloodlust, arcane_charge(4)
0:41.222 aoe o arcane_explosion Fluffy_Pillow 57030.5/63371: 90% mana
0:42.528 aoe o arcane_explosion Fluffy_Pillow 53685.8/63371: 85% mana arcane_charge
0:43.833 aoe o arcane_explosion Fluffy_Pillow 50339.8/63371: 79% mana arcane_charge(2)
0:45.140 aoe o arcane_explosion Fluffy_Pillow 46996.3/63371: 74% mana arcane_charge(3)
0:46.448 aoe p arcane_barrage Fluffy_Pillow 43654.1/63371: 69% mana arcane_charge(4)
0:47.754 aoe o arcane_explosion Fluffy_Pillow 47844.2/63371: 75% mana
0:49.063 aoe o arcane_explosion Fluffy_Pillow 44503.3/63371: 70% mana arcane_charge
0:50.369 aoe j touch_of_the_magi Fluffy_Pillow 41158.5/63371: 65% mana arcane_charge(2)
0:51.676 aoe l rune_of_power Fluffy_Pillow 40315.1/63371: 64% mana arcane_charge(4)
0:52.984 aoe p arcane_barrage Fluffy_Pillow 41972.9/63371: 66% mana arcane_charge(4), rune_of_power
0:54.291 aoe m arcane_orb Fluffy_Pillow 46164.3/63371: 73% mana rune_of_power
0:55.596 aoe p arcane_barrage Fluffy_Pillow 47318.3/63371: 75% mana arcane_charge(4), rune_of_power
0:56.904 aoe o arcane_explosion Fluffy_Pillow 51510.9/63371: 81% mana rune_of_power
0:58.211 aoe o arcane_explosion Fluffy_Pillow 48167.4/63371: 76% mana arcane_charge, rune_of_power
0:59.518 aoe o arcane_explosion Fluffy_Pillow 44824.0/63371: 71% mana arcane_charge(2), rune_of_power
1:00.824 aoe o arcane_explosion Fluffy_Pillow 41479.2/63371: 65% mana arcane_charge(3), rune_of_power
1:02.132 aoe p arcane_barrage Fluffy_Pillow 38137.0/63371: 60% mana arcane_charge(4), rune_of_power
1:03.439 aoe o arcane_explosion Fluffy_Pillow 42328.4/63371: 67% mana rune_of_power
1:04.747 aoe o arcane_explosion Fluffy_Pillow 38986.2/63371: 62% mana arcane_charge, rune_of_power
1:06.054 aoe o arcane_explosion Fluffy_Pillow 35642.7/63371: 56% mana arcane_charge(2)
1:07.362 aoe o arcane_explosion Fluffy_Pillow 32300.5/63371: 51% mana arcane_charge(3)
1:08.670 aoe p arcane_barrage Fluffy_Pillow 28958.3/63371: 46% mana arcane_charge(4)
1:09.978 aoe o arcane_explosion Fluffy_Pillow 33151.0/63371: 52% mana
1:11.284 aoe o arcane_explosion Fluffy_Pillow 29806.2/63371: 47% mana arcane_charge
1:12.590 aoe o arcane_explosion Fluffy_Pillow 26461.5/63371: 42% mana arcane_charge(2)
1:13.895 aoe o arcane_explosion Fluffy_Pillow 23115.5/63371: 36% mana arcane_charge(3)
1:15.203 aoe n shifting_power Fluffy_Pillow 19773.3/63371: 31% mana arcane_charge(4), clearcasting
1:18.947 aoe p arcane_barrage Fluffy_Pillow 22018.5/63371: 35% mana arcane_charge(4), clearcasting
1:20.253 aoe m arcane_orb Fluffy_Pillow 26208.7/63371: 41% mana clearcasting
1:21.560 aoe p arcane_barrage Fluffy_Pillow 27365.2/63371: 43% mana arcane_charge(4), clearcasting
1:22.866 aoe o arcane_explosion Fluffy_Pillow 31555.3/63371: 50% mana clearcasting
1:24.172 aoe o arcane_explosion Fluffy_Pillow 33210.6/63371: 52% mana arcane_charge
1:25.479 aoe o arcane_explosion Fluffy_Pillow 29867.1/63371: 47% mana arcane_charge(2)
1:26.786 aoe o arcane_explosion Fluffy_Pillow 26523.6/63371: 42% mana arcane_charge(3)
1:28.093 aoe p arcane_barrage Fluffy_Pillow 23180.2/63371: 37% mana arcane_charge(4)
1:29.400 aoe o arcane_explosion Fluffy_Pillow 27371.6/63371: 43% mana
1:30.707 aoe o arcane_explosion Fluffy_Pillow 24028.1/63371: 38% mana arcane_charge
1:32.013 aoe o arcane_explosion Fluffy_Pillow 20683.3/63371: 33% mana arcane_charge(2)
1:33.320 aoe o arcane_explosion Fluffy_Pillow 17339.9/63371: 27% mana arcane_charge(3)
1:34.626 aoe p arcane_barrage Fluffy_Pillow 13995.1/63371: 22% mana arcane_charge(4)
1:35.932 aoe o arcane_explosion Fluffy_Pillow 18185.3/63371: 29% mana
1:37.239 aoe j touch_of_the_magi Fluffy_Pillow 14841.8/63371: 23% mana arcane_charge
1:38.547 aoe k arcane_power Fluffy_Pillow 13999.6/63371: 22% mana arcane_charge(4)
1:38.547 aoe p arcane_barrage Fluffy_Pillow 13999.6/63371: 22% mana arcane_charge(4), arcane_power, rune_of_power
1:39.853 aoe o arcane_explosion Fluffy_Pillow 18189.7/63371: 29% mana arcane_power, rune_of_power
1:41.160 aoe o arcane_explosion Fluffy_Pillow 17346.2/63371: 27% mana arcane_charge, arcane_power, rune_of_power
1:42.467 aoe o arcane_explosion Fluffy_Pillow 16502.8/63371: 26% mana arcane_charge(2), arcane_power, rune_of_power
1:43.774 aoe o arcane_explosion Fluffy_Pillow 15659.3/63371: 25% mana arcane_charge(3), arcane_power, rune_of_power
1:45.080 aoe p arcane_barrage Fluffy_Pillow 14814.5/63371: 23% mana arcane_charge(4), arcane_power, rune_of_power
1:46.389 aoe m arcane_orb Fluffy_Pillow 19008.5/63371: 30% mana arcane_power, rune_of_power
1:47.696 aoe p arcane_barrage Fluffy_Pillow 20415.0/63371: 32% mana arcane_charge(4), arcane_power, rune_of_power
1:49.000 aoe o arcane_explosion Fluffy_Pillow 24602.6/63371: 39% mana arcane_power, rune_of_power
1:50.308 aoe o arcane_explosion Fluffy_Pillow 23760.4/63371: 37% mana arcane_charge, arcane_power, rune_of_power
1:51.614 aoe o arcane_explosion Fluffy_Pillow 22915.6/63371: 36% mana arcane_charge(2), arcane_power
1:52.921 aoe o arcane_explosion Fluffy_Pillow 22072.2/63371: 35% mana arcane_charge(3), arcane_power
1:54.227 aoe l rune_of_power Fluffy_Pillow 21227.4/63371: 33% mana arcane_charge(4)
1:55.533 aoe p arcane_barrage Fluffy_Pillow 22882.7/63371: 36% mana arcane_charge(4), rune_of_power
1:56.841 aoe o arcane_explosion Fluffy_Pillow 27075.3/63371: 43% mana rune_of_power
1:58.146 aoe o arcane_explosion Fluffy_Pillow 23729.3/63371: 37% mana arcane_charge, rune_of_power
1:59.450 aoe o arcane_explosion Fluffy_Pillow 20382.1/63371: 32% mana arcane_charge(2), clearcasting, rune_of_power
2:00.757 aoe o arcane_explosion Fluffy_Pillow 22038.6/63371: 35% mana arcane_charge(3), rune_of_power
2:02.063 aoe p arcane_barrage Fluffy_Pillow 18693.9/63371: 29% mana arcane_charge(4), rune_of_power
2:03.371 aoe o arcane_explosion Fluffy_Pillow 22886.5/63371: 36% mana rune_of_power
2:04.677 aoe o arcane_explosion Fluffy_Pillow 19541.8/63371: 31% mana arcane_charge, rune_of_power
2:05.983 aoe o arcane_explosion Fluffy_Pillow 16197.0/63371: 26% mana arcane_charge(2), clearcasting, rune_of_power
2:07.290 aoe o arcane_explosion Fluffy_Pillow 17853.6/63371: 28% mana arcane_charge(3), rune_of_power
2:08.597 aoe n shifting_power Fluffy_Pillow 14510.1/63371: 23% mana arcane_charge(4)
2:12.362 aoe p arcane_barrage Fluffy_Pillow 16782.0/63371: 26% mana arcane_charge(4)
2:13.669 aoe m arcane_orb Fluffy_Pillow 20973.3/63371: 33% mana
2:14.976 aoe p arcane_barrage Fluffy_Pillow 22129.9/63371: 35% mana arcane_charge(4)
2:16.283 aoe o arcane_explosion Fluffy_Pillow 26321.3/63371: 42% mana
2:17.590 aoe o arcane_explosion Fluffy_Pillow 22977.8/63371: 36% mana arcane_charge
2:18.896 aoe o arcane_explosion Fluffy_Pillow 19633.1/63371: 31% mana arcane_charge(2)
2:20.203 aoe o arcane_explosion Fluffy_Pillow 16289.6/63371: 26% mana arcane_charge(3)
2:21.511 aoe p arcane_barrage Fluffy_Pillow 12947.4/63371: 20% mana arcane_charge(4)
2:22.820 aoe o arcane_explosion Fluffy_Pillow 17141.3/63371: 27% mana
2:24.128 shared_cds r use_mana_gem NightFae_Dream 13799.1/63371: 22% mana arcane_charge
2:24.128 aoe o arcane_explosion Fluffy_Pillow 20136.2/63371: 32% mana arcane_charge
2:25.434 aoe o arcane_explosion Fluffy_Pillow 16791.5/63371: 26% mana arcane_charge(2)
2:26.740 aoe o arcane_explosion Fluffy_Pillow 13446.8/63371: 21% mana arcane_charge(3)
2:28.047 aoe p arcane_barrage Fluffy_Pillow 10103.3/63371: 16% mana arcane_charge(4)
2:29.351 aoe j touch_of_the_magi Fluffy_Pillow 14290.9/63371: 23% mana
2:30.658 aoe l rune_of_power Fluffy_Pillow 13447.4/63371: 21% mana arcane_charge(4), clearcasting
2:31.965 aoe p arcane_barrage Fluffy_Pillow 15103.9/63371: 24% mana arcane_charge(4), clearcasting, rune_of_power
2:33.270 aoe o arcane_explosion Fluffy_Pillow 19292.8/63371: 30% mana clearcasting, rune_of_power
2:34.577 aoe o arcane_explosion Fluffy_Pillow 20949.3/63371: 33% mana arcane_charge, rune_of_power
2:35.886 aoe o arcane_explosion Fluffy_Pillow 17608.4/63371: 28% mana arcane_charge(2), clearcasting, rune_of_power
2:37.194 aoe o arcane_explosion Fluffy_Pillow 19266.2/63371: 30% mana arcane_charge(3), rune_of_power
2:38.499 aoe p arcane_barrage Fluffy_Pillow 15920.2/63371: 25% mana arcane_charge(4), clearcasting, rune_of_power
2:39.805 aoe m arcane_orb Fluffy_Pillow 20110.3/63371: 32% mana clearcasting, rune_of_power
2:41.112 aoe p arcane_barrage Fluffy_Pillow 21266.8/63371: 34% mana arcane_charge(4), clearcasting, rune_of_power
2:42.419 aoe o arcane_explosion Fluffy_Pillow 25458.2/63371: 40% mana clearcasting, rune_of_power
2:43.725 aoe o arcane_explosion Fluffy_Pillow 27113.5/63371: 43% mana arcane_charge, rune_of_power
2:45.031 aoe o arcane_explosion Fluffy_Pillow 23768.7/63371: 38% mana arcane_charge(2)
2:46.338 aoe o arcane_explosion Fluffy_Pillow 20425.3/63371: 32% mana arcane_charge(3)
2:47.647 aoe p arcane_barrage Fluffy_Pillow 17084.3/63371: 27% mana arcane_charge(4)
2:48.953 aoe o arcane_explosion Fluffy_Pillow 21274.4/63371: 34% mana
2:50.260 aoe o arcane_explosion Fluffy_Pillow 17931.0/63371: 28% mana arcane_charge
2:51.567 aoe o arcane_explosion Fluffy_Pillow 14587.5/63371: 23% mana arcane_charge(2)
2:52.874 aoe o arcane_explosion Fluffy_Pillow 11244.0/63371: 18% mana arcane_charge(3)
2:54.182 aoe n shifting_power Fluffy_Pillow 7901.8/63371: 12% mana arcane_charge(4)
2:57.869 aoe p arcane_barrage Fluffy_Pillow 10074.8/63371: 16% mana arcane_charge(4)
2:59.176 aoe m arcane_orb Fluffy_Pillow 14266.2/63371: 23% mana
3:00.482 aoe p arcane_barrage Fluffy_Pillow 15421.5/63371: 24% mana arcane_charge(4)
3:01.788 aoe o arcane_explosion Fluffy_Pillow 19611.6/63371: 31% mana
3:03.095 aoe o arcane_explosion Fluffy_Pillow 16268.1/63371: 26% mana arcane_charge
3:04.400 aoe o arcane_explosion Fluffy_Pillow 12922.1/63371: 20% mana arcane_charge(2)
3:05.707 aoe o arcane_explosion Fluffy_Pillow 9578.7/63371: 15% mana arcane_charge(3)
3:07.012 aoe p arcane_barrage Fluffy_Pillow 6232.6/63371: 10% mana arcane_charge(4)
3:08.319 aoe o arcane_explosion Fluffy_Pillow 10424.0/63371: 16% mana
3:09.626 aoe o arcane_explosion Fluffy_Pillow 7080.6/63371: 11% mana arcane_charge
3:10.934 aoe q evocation NightFae_Dream 3738.4/63371: 6% mana arcane_charge(2)
3:15.279 aoe j touch_of_the_magi Fluffy_Pillow 57584.3/63371: 91% mana arcane_charge(2)
3:16.586 aoe k arcane_power Fluffy_Pillow 56740.8/63371: 90% mana arcane_charge(4)
3:16.586 shared_cds t berserking Fluffy_Pillow 56740.8/63371: 90% mana arcane_charge(4), arcane_power, rune_of_power
3:16.586 aoe p arcane_barrage Fluffy_Pillow 56740.8/63371: 90% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.777 aoe o arcane_explosion Fluffy_Pillow 60785.2/63371: 96% mana berserking, arcane_power, rune_of_power
3:18.965 aoe o arcane_explosion Fluffy_Pillow 59790.9/63371: 94% mana berserking, arcane_charge, arcane_power, rune_of_power
3:20.153 aoe o arcane_explosion Fluffy_Pillow 58796.6/63371: 93% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:21.341 aoe o arcane_explosion Fluffy_Pillow 57802.3/63371: 91% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.529 aoe p arcane_barrage Fluffy_Pillow 56808.0/63371: 90% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.717 aoe m arcane_orb Fluffy_Pillow 60848.6/63371: 96% mana berserking, arcane_power, rune_of_power
3:24.904 aoe p arcane_barrage Fluffy_Pillow 62103.0/63371: 98% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:26.093 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power
3:27.282 aoe o arcane_explosion Fluffy_Pillow 62378.4/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power
3:28.470 aoe o arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.657 aoe o arcane_explosion Fluffy_Pillow 60388.5/63371: 95% mana arcane_charge(3), arcane_power
3:30.963 aoe l rune_of_power Fluffy_Pillow 59543.8/63371: 94% mana arcane_charge(4), arcane_power
3:32.269 aoe p arcane_barrage Fluffy_Pillow 61199.1/63371: 97% mana arcane_charge(4), rune_of_power
3:33.576 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:34.883 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, clearcasting, rune_of_power
3:36.190 aoe o arcane_explosion Fluffy_Pillow 61684.5/63371: 97% mana arcane_charge(2), rune_of_power
3:37.495 aoe o arcane_explosion Fluffy_Pillow 58338.5/63371: 92% mana arcane_charge(3), clearcasting, rune_of_power
3:38.802 aoe p arcane_barrage Fluffy_Pillow 59995.0/63371: 95% mana arcane_charge(4), rune_of_power
3:40.109 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:41.415 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
3:42.721 aoe o arcane_explosion Fluffy_Pillow 56682.0/63371: 89% mana arcane_charge(2), clearcasting, rune_of_power
3:44.027 aoe o arcane_explosion Fluffy_Pillow 58337.2/63371: 92% mana arcane_charge(3), rune_of_power
3:45.335 aoe n shifting_power Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), clearcasting
3:49.114 aoe p arcane_barrage Fluffy_Pillow 57284.6/63371: 90% mana arcane_charge(4), clearcasting(2)
3:50.421 aoe m arcane_orb Fluffy_Pillow 61476.0/63371: 97% mana clearcasting(2)
3:51.727 aoe p arcane_barrage Fluffy_Pillow 62631.3/63371: 99% mana arcane_charge(4), clearcasting(2)
3:53.034 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting(2)
3:54.341 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, clearcasting
3:55.649 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(2)
3:56.955 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge(3)
3:58.262 aoe p arcane_barrage Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(4)
3:59.571 aoe o arcane_explosion Fluffy_Pillow 60877.1/63371: 96% mana
4:00.877 aoe o arcane_explosion Fluffy_Pillow 57532.4/63371: 91% mana arcane_charge
4:02.181 aoe o arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana arcane_charge(2)
4:03.487 aoe o arcane_explosion Fluffy_Pillow 50840.4/63371: 80% mana arcane_charge(3), clearcasting
4:04.793 aoe p arcane_barrage Fluffy_Pillow 52495.7/63371: 83% mana arcane_charge(4)
4:06.099 aoe j touch_of_the_magi Fluffy_Pillow 56685.8/63371: 89% mana
4:07.407 aoe l rune_of_power Fluffy_Pillow 55843.6/63371: 88% mana arcane_charge(4)
4:08.714 aoe p arcane_barrage Fluffy_Pillow 57500.1/63371: 91% mana arcane_charge(4), rune_of_power
4:10.021 aoe o arcane_explosion Fluffy_Pillow 61691.5/63371: 97% mana rune_of_power
4:11.328 aoe o arcane_explosion Fluffy_Pillow 58348.0/63371: 92% mana arcane_charge, rune_of_power
4:12.635 aoe o arcane_explosion Fluffy_Pillow 55004.5/63371: 87% mana arcane_charge(2), clearcasting, rune_of_power
4:13.942 aoe o arcane_explosion Fluffy_Pillow 56661.1/63371: 89% mana arcane_charge(3), rune_of_power
4:15.249 aoe p arcane_barrage Fluffy_Pillow 53317.6/63371: 84% mana arcane_charge(4), rune_of_power
4:16.555 aoe m arcane_orb Fluffy_Pillow 57507.7/63371: 91% mana rune_of_power
4:17.862 aoe p arcane_barrage Fluffy_Pillow 58664.2/63371: 93% mana arcane_charge(4), rune_of_power
4:19.168 aoe o arcane_explosion Fluffy_Pillow 62854.4/63371: 99% mana rune_of_power
4:20.476 aoe o arcane_explosion Fluffy_Pillow 59512.2/63371: 94% mana arcane_charge, rune_of_power
4:21.782 aoe o arcane_explosion Fluffy_Pillow 56167.4/63371: 89% mana arcane_charge(2)
4:23.089 aoe o arcane_explosion Fluffy_Pillow 52824.0/63371: 83% mana arcane_charge(3)
4:24.395 shared_cds r use_mana_gem NightFae_Dream 49479.2/63371: 78% mana arcane_charge(4)
4:24.395 aoe p arcane_barrage Fluffy_Pillow 55816.4/63371: 88% mana arcane_charge(4)
4:25.700 aoe o arcane_explosion Fluffy_Pillow 60005.2/63371: 95% mana
4:27.007 aoe o arcane_explosion Fluffy_Pillow 56661.7/63371: 89% mana arcane_charge
4:28.312 aoe o arcane_explosion Fluffy_Pillow 53315.7/63371: 84% mana arcane_charge(2), clearcasting
4:29.620 aoe o arcane_explosion Fluffy_Pillow 54973.5/63371: 87% mana arcane_charge(3)
4:30.925 aoe n shifting_power Fluffy_Pillow 51627.5/63371: 81% mana arcane_charge(4)
4:34.592 aoe p arcane_barrage Fluffy_Pillow 53775.2/63371: 85% mana arcane_charge(4)
4:35.899 aoe m arcane_orb Fluffy_Pillow 57966.6/63371: 91% mana
4:37.205 aoe p arcane_barrage Fluffy_Pillow 59121.8/63371: 93% mana arcane_charge(4)
4:38.512 aoe o arcane_explosion Fluffy_Pillow 63313.2/63371: 100% mana
4:39.819 aoe o arcane_explosion Fluffy_Pillow 59969.7/63371: 95% mana arcane_charge
4:41.126 aoe o arcane_explosion Fluffy_Pillow 56626.3/63371: 89% mana arcane_charge(2)
4:42.434 aoe o arcane_explosion Fluffy_Pillow 53284.1/63371: 84% mana arcane_charge(3)
4:43.742 aoe p arcane_barrage Fluffy_Pillow 49941.9/63371: 79% mana arcane_charge(4)
4:45.048 aoe o arcane_explosion Fluffy_Pillow 54132.0/63371: 85% mana
4:46.355 aoe o arcane_explosion Fluffy_Pillow 50788.5/63371: 80% mana arcane_charge
4:47.661 aoe o arcane_explosion Fluffy_Pillow 47443.8/63371: 75% mana arcane_charge(2)
4:48.968 aoe o arcane_explosion Fluffy_Pillow 44100.3/63371: 70% mana arcane_charge(3)
4:50.274 aoe p arcane_barrage Fluffy_Pillow 40755.6/63371: 64% mana arcane_charge(4), clearcasting
4:51.580 aoe j touch_of_the_magi Fluffy_Pillow 44945.7/63371: 71% mana clearcasting
4:52.887 aoe k arcane_power Fluffy_Pillow 44102.2/63371: 70% mana arcane_charge(4), clearcasting
4:52.887 aoe p arcane_barrage Fluffy_Pillow 44102.2/63371: 70% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:54.194 aoe o arcane_explosion Fluffy_Pillow 48293.6/63371: 76% mana arcane_power, clearcasting, rune_of_power
4:55.500 aoe o arcane_explosion Fluffy_Pillow 49948.9/63371: 79% mana arcane_charge, arcane_power, rune_of_power
4:56.807 aoe o arcane_explosion Fluffy_Pillow 49105.4/63371: 77% mana arcane_charge(2), arcane_power, rune_of_power
4:58.113 aoe o arcane_explosion Fluffy_Pillow 48260.7/63371: 76% mana arcane_charge(3), arcane_power, rune_of_power
4:59.419 aoe p arcane_barrage Fluffy_Pillow 47415.9/63371: 75% mana arcane_charge(4), arcane_power, rune_of_power
5:00.725 aoe m arcane_orb Fluffy_Pillow 51606.0/63371: 81% mana arcane_power, rune_of_power
5:02.032 shared_cds s potion Fluffy_Pillow 53012.6/63371: 84% mana arcane_charge(4), arcane_power, rune_of_power
5:02.032 aoe p arcane_barrage Fluffy_Pillow 53012.6/63371: 84% mana arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
5:03.339 aoe o arcane_explosion Fluffy_Pillow 57204.0/63371: 90% mana arcane_power, rune_of_power, potion_of_deathly_fixation
5:04.645 aoe o arcane_explosion Fluffy_Pillow 56359.2/63371: 89% mana arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
5:05.952 aoe o arcane_explosion Fluffy_Pillow 55515.7/63371: 88% mana arcane_charge(2), arcane_power, potion_of_deathly_fixation
5:07.259 aoe o arcane_explosion Fluffy_Pillow 54672.3/63371: 86% mana arcane_charge(3), arcane_power, clearcasting, potion_of_deathly_fixation
5:08.566 aoe l rune_of_power Fluffy_Pillow 56328.8/63371: 89% mana arcane_charge(4), potion_of_deathly_fixation
5:09.871 aoe p arcane_barrage Fluffy_Pillow 57982.8/63371: 91% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:11.179 aoe o arcane_explosion Fluffy_Pillow 62175.5/63371: 98% mana rune_of_power, potion_of_deathly_fixation
5:12.485 aoe o arcane_explosion Fluffy_Pillow 58830.7/63371: 93% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:13.791 aoe o arcane_explosion Fluffy_Pillow 55486.0/63371: 88% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:15.096 aoe o arcane_explosion Fluffy_Pillow 52140.0/63371: 82% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:16.402 aoe p arcane_barrage Fluffy_Pillow 48795.2/63371: 77% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.709 aoe o arcane_explosion Fluffy_Pillow 52986.6/63371: 84% mana rune_of_power, potion_of_deathly_fixation
5:19.014 aoe o arcane_explosion Fluffy_Pillow 49640.6/63371: 78% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:20.320 aoe o arcane_explosion Fluffy_Pillow 46295.9/63371: 73% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.628 aoe o arcane_explosion Fluffy_Pillow 42953.7/63371: 68% mana arcane_charge(3), rune_of_power, potion_of_deathly_fixation
5:22.933 aoe n shifting_power Fluffy_Pillow 39607.7/63371: 63% mana arcane_charge(4), potion_of_deathly_fixation

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream_SB : 17139 dps, 4669 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17138.8 17138.8 19.5 / 0.114% 1257.5 / 7.3% 9.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
1890.5 1783.4 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 17139
Arcane Barrage 5714 33.3% 53.9 5.53sec 31510 25465 Direct 269.0 5286 10601 6312 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 53.88 269.03 0.00 0.00 1.2374 0.0000 1697650.83 1697650.83 0.00% 25465.02 25465.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 217.05 167 276 5285.72 2082 25810 5285.37 4792 5867 1146878 1146878 0.00%
crit 19.32% 51.98 29 86 10601.33 4164 51620 10594.03 7859 13696 550773 550773 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:53.89
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 482 2.8% 40.9 6.90sec 3493 0 Direct 204.6 586 1172 699 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.93 204.64 0.00 0.00 0.0000 0.0000 142959.62 142959.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 165.32 123 216 585.97 443 682 585.87 567 607 96864 96864 0.00%
crit 19.21% 39.32 21 64 1172.49 886 1364 1172.11 1068 1278 46095 46095 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7552 44.1% 141.2 2.08sec 15893 12778 Direct 706.1 2664 5326 3178 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 141.21 706.06 0.00 0.00 1.2438 0.0000 2244237.70 2244237.70 0.00% 12778.07 12778.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 569.62 449 703 2664.10 1958 4221 2664.56 2577 2742 1517660 1517660 0.00%
crit 19.32% 136.43 89 191 5325.65 3916 8442 5326.31 4770 5744 726578 726578 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:141.22
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1475) 0.0% (8.6%) 13.3 22.99sec 32871 26866

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.33 0.00 0.00 0.00 1.2236 0.0000 0.00 0.00 0.00% 26865.51 26865.51

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.33
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1475 8.6% 66.6 22.99sec 6584 0 Direct 66.6 5525 11015 6581 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.56 66.56 0.00 0.00 0.0000 0.0000 438230.15 438230.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 53.74 36 73 5525.28 3869 8342 5526.63 5076 5904 297006 297006 0.00%
crit 19.27% 12.82 4 25 11015.09 7739 16685 10996.75 7790 14373 141224 141224 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.5%) 18.3 9.04sec 1413 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.5% 18.3 9.04sec 1413 0 Direct 18.3 1181 2363 1413 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.26 18.26 0.00 0.00 0.0000 0.0000 25794.25 25794.25 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.41% 14.68 4 29 1181.44 1164 1195 1181.47 1167 1195 17342 17342 0.00%
crit 19.59% 3.58 0 11 2362.87 2327 2389 2276.30 0 2389 8452 8452 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1520 3040 1830 20.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1830.70 1830.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.57% 0.80 0 1 1520.16 1520 1520 1209.62 0 1520 1210 1210 0.00%
crit 20.43% 0.20 0 1 3040.32 3040 3040 621.08 0 3040 621 621 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5867 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 147  / 20 0.1% 90.0 1.29sec 65 50 Direct 90.0 55 109 65 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5867.03 5867.03 0.00% 49.81 49.81
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 72.60 58 83 54.60 43 62 54.60 53 56 3964 3964 0.00%
crit 19.33% 17.40 7 32 109.38 86 124 109.43 99 122 1903 1903 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 667 3.9% 6.0 48.44sec 33011 9246 Periodic 119.6 1389 2779 1660 19.5% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 0.00 23.92 119.59 3.5703 0.8346 198480.72 198480.72 0.00% 9246.28 9246.28
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.54% 96.32 70 124 1389.41 1372 1409 1389.23 1382 1397 133826 133826 0.00%
crit 19.46% 23.27 10 43 2778.99 2745 2818 2778.60 2754 2803 64655 64655 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.01
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1137) 0.0% (6.6%) 6.6 48.83sec 51342 39300

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.57 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 39300.35 39300.35

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.60
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1137 6.6% 6.6 48.69sec 51342 0 Direct 32.7 10334 0 10334 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.57 32.67 0.00 0.00 0.0000 0.0000 337275.62 337275.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.67 25 40 10333.72 2270 52236 10345.80 8662 13081 337276 337276 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11193.81
  • base_dd_max:11193.81
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.5 97.16sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.53
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.63sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.2 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.25 0.00 1.46 0.00 4.2202 0.7198 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.25
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.46sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.45
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 47.06sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 0.00 0.00 0.00 1.2597 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.44
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.68sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.78
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 54.6 173.0 5.5sec 1.3sec 4.1sec 75.62% 0.00% 28.7 (29.8) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.16%
  • arcane_charge_2:15.59%
  • arcane_charge_3:14.63%
  • arcane_charge_4:27.24%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.5 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.8sec 194.8sec 12.0sec 8.18% 23.72% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.3s
  • trigger_min/max:192.7s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.18%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.2 0.2 12.9sec 12.8sec 2.3sec 16.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.47%
  • clearcasting_2:0.35%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.2 0.0 0.0sec 0.0sec 4.2sec 0.35% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.36%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.2sec 11.14% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.14%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.1sec 31.1sec 11.8sec 39.35% 0.00% 0.0 (0.0) 9.6

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.8s
  • trigger_min/max:14.4s / 48.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.35%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.2 0.0 10.0sec 10.0sec 5.0sec 50.42% 0.00% 0.0 (0.0) 29.7

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.42%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.65% 0.76% 6.06% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000201.405144.026263.962
Evocation233.042127.298350.918284.258180.283359.962
Rune of Power13.4490.00931.46789.60172.339109.553
Touch of the Magi12.2190.00021.54483.28467.993107.019
Arcane Power1.2330.0036.1034.3471.9839.084
Arcane Barrage3.0320.00312.112164.675132.163200.226
Arcane Orb4.2430.00011.63757.28742.14776.852
Shifting Power7.8880.00030.23147.62542.79857.137

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 686.50 369120.20 69.57% 537.68 7296.72 1.94%
Evocation Mana 11.86 11923.54 2.25% 1005.05 0.00 0.00%
Mana Gem Mana 2.78 17595.74 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 53.89 131967.24 24.87% 2449.02 4625.22 3.39%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1783.36 1890.50 11918.8 31507.3 989.7 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 141.2 524105.1 3711.2 3711.5 4.3
arcane_orb Mana 13.3 5802.1 435.3 435.2 75.5
shifting_power Mana 6.0 15030.8 2500.0 2499.9 13.2
touch_of_the_magi Mana 6.6 16438.0 2500.0 2502.3 20.5

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
NightFae_Dream_SB Damage Per Second
Count 1121
Mean 17138.78
Minimum 16044.25
Maximum 18173.30
Spread ( max - min ) 2129.05
Range [ ( max - min ) / 2 * 100% ] 6.21%
Standard Deviation 333.6730
5th Percentile 16608.18
95th Percentile 17690.02
( 95th Percentile - 5th Percentile ) 1081.84
Mean Distribution
Standard Deviation 9.9659
95.00% Confidence Interval ( 17119.24 - 17158.31 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1457
0.1 Scale Factor Error with Delta=300 951
0.05 Scale Factor Error with Delta=300 3802
0.01 Scale Factor Error with Delta=300 95045
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1121
Mean 4668.65
Minimum 4097.16
Maximum 5158.91
Spread ( max - min ) 1061.75
Range [ ( max - min ) / 2 * 100% ] 11.37%
Standard Deviation 161.9796
5th Percentile 4412.81
95th Percentile 4939.74
( 95th Percentile - 5th Percentile ) 526.93
Mean Distribution
Standard Deviation 4.8379
95.00% Confidence Interval ( 4659.17 - 4678.14 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4625
0.1 Scale Factor Error with Delta=300 224
0.05 Scale Factor Error with Delta=300 896
0.01 Scale Factor Error with Delta=300 22398
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1121
Mean 17138.78
Minimum 16044.25
Maximum 18173.30
Spread ( max - min ) 2129.05
Range [ ( max - min ) / 2 * 100% ] 6.21%
Damage
NightFae_Dream_SB Damage
Count 1121
Mean 5086459.60
Minimum 4087153.74
Maximum 6180340.60
Spread ( max - min ) 2093186.86
Range [ ( max - min ) / 2 * 100% ] 20.58%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.60 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.53 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.44 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.33 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.01 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 141.22 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 53.89 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.25 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.78 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.45 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooropmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooproooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpoooropoooonpmpoooopoooopjkpoooopmspoooolpoooopoooon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana social_butterfly
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), social_butterfly
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:03.135 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.048 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.962 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:05.876 aoe o arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.792 aoe o arcane_explosion Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.706 aoe p arcane_barrage Fluffy_Pillow 58007.7/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:08.621 aoe o arcane_explosion Fluffy_Pillow 61702.2/63371: 97% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:09.535 aoe o arcane_explosion Fluffy_Pillow 62860.7/63371: 99% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.449 aoe o arcane_explosion Fluffy_Pillow 61519.1/63371: 97% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:11.363 aoe o arcane_explosion Fluffy_Pillow 62677.5/63371: 99% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:12.277 aoe p arcane_barrage Fluffy_Pillow 61336.0/63371: 97% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:13.191 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:14.106 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, arcane_charge, arcane_power, social_butterfly, potion_of_deathly_fixation
0:15.114 aoe o arcane_explosion Fluffy_Pillow 60808.7/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.120 aoe o arcane_explosion Fluffy_Pillow 59583.7/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.127 aoe l rune_of_power Fluffy_Pillow 58360.0/63371: 92% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.133 aoe p arcane_barrage Fluffy_Pillow 59635.1/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.141 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.146 aoe o arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:21.154 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.162 shared_cds r use_mana_gem NightFae_Dream_SB 52200.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.162 aoe o arcane_explosion Fluffy_Pillow 58537.5/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.169 aoe p arcane_barrage Fluffy_Pillow 54813.8/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:24.177 aoe m arcane_orb Fluffy_Pillow 58626.2/63371: 93% mana bloodlust, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:25.185 aoe p arcane_barrage Fluffy_Pillow 59403.8/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.194 aoe o arcane_explosion Fluffy_Pillow 63217.5/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.199 aoe o arcane_explosion Fluffy_Pillow 59491.2/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:28.206 aoe o arcane_explosion Fluffy_Pillow 60767.5/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power
0:29.212 aoe o arcane_explosion Fluffy_Pillow 57042.6/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:30.219 aoe n shifting_power Fluffy_Pillow 53318.9/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, social_butterfly
0:33.166 aoe p arcane_barrage Fluffy_Pillow 54554.0/63371: 86% mana bloodlust, arcane_charge(4), clearcasting, social_butterfly
0:34.171 aoe m arcane_orb Fluffy_Pillow 58362.6/63371: 92% mana bloodlust, clearcasting, social_butterfly
0:35.176 aoe p arcane_barrage Fluffy_Pillow 59136.4/63371: 93% mana bloodlust, arcane_charge(4), clearcasting
0:36.184 aoe o arcane_explosion Fluffy_Pillow 62948.8/63371: 99% mana bloodlust, clearcasting
0:37.191 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge
0:38.198 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge(2)
0:39.203 aoe o arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(3)
0:40.211 aoe p arcane_barrage Fluffy_Pillow 52199.1/63371: 82% mana bloodlust, arcane_charge(4), social_butterfly
0:41.217 aoe o arcane_explosion Fluffy_Pillow 56009.0/63371: 88% mana social_butterfly
0:42.523 aoe o arcane_explosion Fluffy_Pillow 52664.2/63371: 83% mana arcane_charge, social_butterfly
0:43.830 aoe o arcane_explosion Fluffy_Pillow 49320.7/63371: 78% mana arcane_charge(2), clearcasting, social_butterfly
0:45.139 aoe o arcane_explosion Fluffy_Pillow 50979.8/63371: 80% mana arcane_charge(3)
0:46.446 aoe p arcane_barrage Fluffy_Pillow 47636.3/63371: 75% mana arcane_charge(4), clearcasting
0:47.752 aoe o arcane_explosion Fluffy_Pillow 51826.5/63371: 82% mana clearcasting
0:49.059 aoe o arcane_explosion Fluffy_Pillow 53483.0/63371: 84% mana arcane_charge
0:50.366 aoe j touch_of_the_magi Fluffy_Pillow 50139.5/63371: 79% mana arcane_charge(2), social_butterfly
0:51.672 aoe l rune_of_power Fluffy_Pillow 49294.8/63371: 78% mana arcane_charge(4), clearcasting, social_butterfly
0:52.979 aoe p arcane_barrage Fluffy_Pillow 50951.3/63371: 80% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
0:54.285 aoe m arcane_orb Fluffy_Pillow 55141.4/63371: 87% mana clearcasting, rune_of_power, social_butterfly
0:55.591 aoe p arcane_barrage Fluffy_Pillow 56296.7/63371: 89% mana arcane_charge(4), clearcasting, rune_of_power
0:56.897 aoe o arcane_explosion Fluffy_Pillow 60486.8/63371: 95% mana clearcasting, rune_of_power
0:58.204 aoe o arcane_explosion Fluffy_Pillow 62143.3/63371: 98% mana arcane_charge, rune_of_power
0:59.511 aoe o arcane_explosion Fluffy_Pillow 58799.9/63371: 93% mana arcane_charge(2), rune_of_power
1:00.816 aoe o arcane_explosion Fluffy_Pillow 55453.9/63371: 88% mana arcane_charge(3), clearcasting, rune_of_power, social_butterfly
1:02.124 aoe p arcane_barrage Fluffy_Pillow 57111.7/63371: 90% mana arcane_charge(4), rune_of_power, social_butterfly
1:03.431 aoe o arcane_explosion Fluffy_Pillow 61303.0/63371: 97% mana rune_of_power, social_butterfly
1:04.738 aoe o arcane_explosion Fluffy_Pillow 57959.6/63371: 91% mana arcane_charge, rune_of_power, social_butterfly
1:06.043 aoe o arcane_explosion Fluffy_Pillow 54613.6/63371: 86% mana arcane_charge(2), clearcasting
1:07.351 aoe o arcane_explosion Fluffy_Pillow 56271.4/63371: 89% mana arcane_charge(3)
1:08.657 aoe p arcane_barrage Fluffy_Pillow 52926.6/63371: 84% mana arcane_charge(4)
1:09.963 aoe o arcane_explosion Fluffy_Pillow 57116.7/63371: 90% mana
1:11.269 aoe o arcane_explosion Fluffy_Pillow 53772.0/63371: 85% mana arcane_charge, social_butterfly
1:12.576 aoe o arcane_explosion Fluffy_Pillow 50428.5/63371: 80% mana arcane_charge(2), social_butterfly
1:13.885 aoe o arcane_explosion Fluffy_Pillow 47087.6/63371: 74% mana arcane_charge(3), social_butterfly
1:15.191 aoe n shifting_power Fluffy_Pillow 43742.9/63371: 69% mana arcane_charge(4)
1:18.953 aoe p arcane_barrage Fluffy_Pillow 46010.9/63371: 73% mana arcane_charge(4)
1:20.259 aoe m arcane_orb Fluffy_Pillow 50201.0/63371: 79% mana social_butterfly
1:21.565 aoe p arcane_barrage Fluffy_Pillow 51356.3/63371: 81% mana arcane_charge(4), social_butterfly
1:22.873 aoe o arcane_explosion Fluffy_Pillow 55549.0/63371: 88% mana social_butterfly
1:24.179 aoe o arcane_explosion Fluffy_Pillow 52204.2/63371: 82% mana arcane_charge, clearcasting, social_butterfly
1:25.486 aoe o arcane_explosion Fluffy_Pillow 53860.7/63371: 85% mana arcane_charge(2)
1:26.793 aoe o arcane_explosion Fluffy_Pillow 50517.3/63371: 80% mana arcane_charge(3)
1:28.101 aoe p arcane_barrage Fluffy_Pillow 47175.1/63371: 74% mana arcane_charge(4)
1:29.407 aoe o arcane_explosion Fluffy_Pillow 51365.2/63371: 81% mana
1:30.714 aoe o arcane_explosion Fluffy_Pillow 48021.7/63371: 76% mana arcane_charge, social_butterfly
1:32.021 aoe o arcane_explosion Fluffy_Pillow 44678.3/63371: 71% mana arcane_charge(2), social_butterfly
1:33.328 aoe o arcane_explosion Fluffy_Pillow 41334.8/63371: 65% mana arcane_charge(3), social_butterfly
1:34.634 aoe p arcane_barrage Fluffy_Pillow 37990.0/63371: 60% mana arcane_charge(4), social_butterfly
1:35.942 aoe o arcane_explosion Fluffy_Pillow 42182.7/63371: 67% mana
1:37.250 aoe j touch_of_the_magi Fluffy_Pillow 38840.5/63371: 61% mana arcane_charge
1:38.557 aoe k arcane_power Fluffy_Pillow 37997.0/63371: 60% mana arcane_charge(4)
1:38.557 aoe p arcane_barrage Fluffy_Pillow 37997.0/63371: 60% mana arcane_charge(4), arcane_power, rune_of_power
1:39.863 aoe o arcane_explosion Fluffy_Pillow 42187.1/63371: 67% mana arcane_power, rune_of_power
1:41.167 aoe o arcane_explosion Fluffy_Pillow 41339.9/63371: 65% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:42.474 aoe o arcane_explosion Fluffy_Pillow 40496.4/63371: 64% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly
1:43.783 aoe o arcane_explosion Fluffy_Pillow 39655.5/63371: 63% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:45.088 aoe p arcane_barrage Fluffy_Pillow 38809.5/63371: 61% mana arcane_charge(4), arcane_power, rune_of_power
1:46.393 aoe m arcane_orb Fluffy_Pillow 42998.3/63371: 68% mana arcane_power, rune_of_power
1:47.699 aoe p arcane_barrage Fluffy_Pillow 44403.6/63371: 70% mana arcane_charge(4), arcane_power, rune_of_power
1:49.007 aoe o arcane_explosion Fluffy_Pillow 48596.2/63371: 77% mana arcane_power, rune_of_power
1:50.314 aoe o arcane_explosion Fluffy_Pillow 47752.8/63371: 75% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:51.619 aoe o arcane_explosion Fluffy_Pillow 46906.7/63371: 74% mana arcane_charge(2), arcane_power, social_butterfly
1:52.924 aoe o arcane_explosion Fluffy_Pillow 46060.7/63371: 73% mana arcane_charge(3), arcane_power, social_butterfly
1:54.230 aoe l rune_of_power Fluffy_Pillow 45216.0/63371: 71% mana arcane_charge(4), social_butterfly
1:55.536 aoe p arcane_barrage Fluffy_Pillow 46871.3/63371: 74% mana arcane_charge(4), rune_of_power
1:56.844 aoe o arcane_explosion Fluffy_Pillow 51063.9/63371: 81% mana rune_of_power
1:58.152 aoe o arcane_explosion Fluffy_Pillow 47721.7/63371: 75% mana arcane_charge, rune_of_power
1:59.459 aoe o arcane_explosion Fluffy_Pillow 44378.2/63371: 70% mana arcane_charge(2), clearcasting, rune_of_power
2:00.765 aoe o arcane_explosion Fluffy_Pillow 46033.5/63371: 73% mana arcane_charge(3), rune_of_power, social_butterfly
2:02.071 aoe p arcane_barrage Fluffy_Pillow 42688.8/63371: 67% mana arcane_charge(4), rune_of_power, social_butterfly
2:03.376 aoe o arcane_explosion Fluffy_Pillow 46877.6/63371: 74% mana rune_of_power, social_butterfly
2:04.681 aoe o arcane_explosion Fluffy_Pillow 43531.6/63371: 69% mana arcane_charge, rune_of_power, social_butterfly
2:05.987 aoe o arcane_explosion Fluffy_Pillow 40186.9/63371: 63% mana arcane_charge(2), rune_of_power
2:07.292 aoe o arcane_explosion Fluffy_Pillow 36840.9/63371: 58% mana arcane_charge(3), rune_of_power
2:08.600 aoe n shifting_power Fluffy_Pillow 33498.7/63371: 53% mana arcane_charge(4)
2:12.339 aoe p arcane_barrage Fluffy_Pillow 35737.6/63371: 56% mana arcane_charge(4), social_butterfly
2:13.645 aoe m arcane_orb Fluffy_Pillow 39927.7/63371: 63% mana social_butterfly
2:14.953 aoe p arcane_barrage Fluffy_Pillow 41085.5/63371: 65% mana arcane_charge(4), social_butterfly
2:16.259 aoe o arcane_explosion Fluffy_Pillow 45275.6/63371: 71% mana
2:17.565 aoe o arcane_explosion Fluffy_Pillow 41930.9/63371: 66% mana arcane_charge
2:18.872 aoe o arcane_explosion Fluffy_Pillow 38587.4/63371: 61% mana arcane_charge(2)
2:20.179 aoe o arcane_explosion Fluffy_Pillow 35243.9/63371: 56% mana arcane_charge(3), social_butterfly
2:21.487 aoe p arcane_barrage Fluffy_Pillow 31901.7/63371: 50% mana arcane_charge(4), social_butterfly
2:22.793 shared_cds r use_mana_gem NightFae_Dream_SB 36091.8/63371: 57% mana social_butterfly
2:22.793 aoe o arcane_explosion Fluffy_Pillow 42429.0/63371: 67% mana social_butterfly
2:24.099 aoe o arcane_explosion Fluffy_Pillow 39084.3/63371: 62% mana arcane_charge, social_butterfly
2:25.406 aoe o arcane_explosion Fluffy_Pillow 35740.8/63371: 56% mana arcane_charge(2)
2:26.714 aoe o arcane_explosion Fluffy_Pillow 32398.6/63371: 51% mana arcane_charge(3)
2:28.020 aoe p arcane_barrage Fluffy_Pillow 29053.8/63371: 46% mana arcane_charge(4)
2:29.326 aoe j touch_of_the_magi Fluffy_Pillow 33244.0/63371: 52% mana
2:30.633 aoe l rune_of_power Fluffy_Pillow 32400.5/63371: 51% mana arcane_charge(4), social_butterfly
2:31.939 aoe p arcane_barrage Fluffy_Pillow 34055.8/63371: 54% mana arcane_charge(4), rune_of_power, social_butterfly
2:33.244 aoe o arcane_explosion Fluffy_Pillow 38244.6/63371: 60% mana rune_of_power, social_butterfly
2:34.549 aoe o arcane_explosion Fluffy_Pillow 34898.6/63371: 55% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
2:35.854 aoe o arcane_explosion Fluffy_Pillow 36552.6/63371: 58% mana arcane_charge(2), rune_of_power
2:37.160 aoe o arcane_explosion Fluffy_Pillow 33207.9/63371: 52% mana arcane_charge(3), rune_of_power
2:38.466 aoe p arcane_barrage Fluffy_Pillow 29863.1/63371: 47% mana arcane_charge(4), clearcasting, rune_of_power
2:39.771 aoe m arcane_orb Fluffy_Pillow 34052.0/63371: 54% mana clearcasting, rune_of_power
2:41.079 aoe p arcane_barrage Fluffy_Pillow 35209.8/63371: 56% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
2:42.385 aoe o arcane_explosion Fluffy_Pillow 39399.9/63371: 62% mana clearcasting, rune_of_power, social_butterfly
2:43.690 aoe o arcane_explosion Fluffy_Pillow 41053.9/63371: 65% mana arcane_charge, rune_of_power, social_butterfly
2:44.995 aoe o arcane_explosion Fluffy_Pillow 37707.9/63371: 60% mana arcane_charge(2), social_butterfly
2:46.301 aoe o arcane_explosion Fluffy_Pillow 34363.1/63371: 54% mana arcane_charge(3), clearcasting
2:47.608 aoe p arcane_barrage Fluffy_Pillow 36019.7/63371: 57% mana arcane_charge(4)
2:48.914 aoe o arcane_explosion Fluffy_Pillow 40209.8/63371: 63% mana
2:50.221 aoe o arcane_explosion Fluffy_Pillow 36866.3/63371: 58% mana arcane_charge, social_butterfly
2:51.528 aoe o arcane_explosion Fluffy_Pillow 33522.8/63371: 53% mana arcane_charge(2), clearcasting, social_butterfly
2:52.834 aoe o arcane_explosion Fluffy_Pillow 35178.1/63371: 56% mana arcane_charge(3), social_butterfly
2:54.139 aoe n shifting_power Fluffy_Pillow 31832.1/63371: 50% mana arcane_charge(4), social_butterfly
2:57.813 aoe p arcane_barrage Fluffy_Pillow 33988.6/63371: 54% mana arcane_charge(4), clearcasting
2:59.119 aoe m arcane_orb Fluffy_Pillow 38178.7/63371: 60% mana clearcasting
3:00.426 aoe p arcane_barrage Fluffy_Pillow 39335.3/63371: 62% mana arcane_charge(4), clearcasting, social_butterfly
3:01.733 aoe o arcane_explosion Fluffy_Pillow 43526.7/63371: 69% mana clearcasting, social_butterfly
3:03.040 aoe o arcane_explosion Fluffy_Pillow 45183.2/63371: 71% mana arcane_charge, social_butterfly
3:04.347 aoe o arcane_explosion Fluffy_Pillow 41839.7/63371: 66% mana arcane_charge(2), social_butterfly
3:05.651 aoe o arcane_explosion Fluffy_Pillow 38492.4/63371: 61% mana arcane_charge(3)
3:06.957 aoe p arcane_barrage Fluffy_Pillow 35147.7/63371: 55% mana arcane_charge(4)
3:08.264 aoe o arcane_explosion Fluffy_Pillow 39339.1/63371: 62% mana
3:09.571 aoe o arcane_explosion Fluffy_Pillow 35995.6/63371: 57% mana arcane_charge
3:10.877 aoe o arcane_explosion Fluffy_Pillow 32650.9/63371: 52% mana arcane_charge(2), social_butterfly
3:12.185 aoe o arcane_explosion Fluffy_Pillow 29308.7/63371: 46% mana arcane_charge(3), clearcasting, social_butterfly
3:13.491 aoe p arcane_barrage Fluffy_Pillow 30963.9/63371: 49% mana arcane_charge(4), social_butterfly
3:14.798 aoe j touch_of_the_magi Fluffy_Pillow 35155.3/63371: 55% mana social_butterfly
3:16.105 aoe k arcane_power Fluffy_Pillow 34311.9/63371: 54% mana arcane_charge(4)
3:16.105 shared_cds t berserking Fluffy_Pillow 34311.9/63371: 54% mana arcane_charge(4), arcane_power, rune_of_power
3:16.105 aoe p arcane_barrage Fluffy_Pillow 34311.9/63371: 54% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.294 aoe o arcane_explosion Fluffy_Pillow 38353.7/63371: 61% mana berserking, arcane_power, rune_of_power
3:18.482 aoe o arcane_explosion Fluffy_Pillow 37359.4/63371: 59% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
3:19.671 aoe o arcane_explosion Fluffy_Pillow 38866.4/63371: 61% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.860 aoe o arcane_explosion Fluffy_Pillow 37873.3/63371: 60% mana berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly
3:22.048 aoe p arcane_barrage Fluffy_Pillow 36879.0/63371: 58% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:23.236 aoe m arcane_orb Fluffy_Pillow 40919.6/63371: 65% mana berserking, arcane_power, rune_of_power, social_butterfly
3:24.425 aoe p arcane_barrage Fluffy_Pillow 42176.6/63371: 67% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:25.615 aoe o arcane_explosion Fluffy_Pillow 46219.7/63371: 73% mana berserking, arcane_power, rune_of_power
3:26.804 aoe o arcane_explosion Fluffy_Pillow 45226.6/63371: 71% mana berserking, arcane_charge, arcane_power, rune_of_power
3:27.993 aoe o arcane_explosion Fluffy_Pillow 44233.6/63371: 70% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.183 aoe o arcane_explosion Fluffy_Pillow 43241.9/63371: 68% mana arcane_charge(3), arcane_power
3:30.489 aoe l rune_of_power Fluffy_Pillow 42397.1/63371: 67% mana arcane_charge(4), arcane_power, social_butterfly
3:31.794 aoe p arcane_barrage Fluffy_Pillow 44051.1/63371: 70% mana arcane_charge(4), rune_of_power, social_butterfly
3:33.100 aoe o arcane_explosion Fluffy_Pillow 48241.2/63371: 76% mana rune_of_power, social_butterfly
3:34.406 aoe o arcane_explosion Fluffy_Pillow 44896.5/63371: 71% mana arcane_charge, clearcasting, rune_of_power, social_butterfly
3:35.713 aoe o arcane_explosion Fluffy_Pillow 46553.0/63371: 73% mana arcane_charge(2), rune_of_power
3:37.020 aoe o arcane_explosion Fluffy_Pillow 43209.6/63371: 68% mana arcane_charge(3), clearcasting, rune_of_power
3:38.327 aoe p arcane_barrage Fluffy_Pillow 44866.1/63371: 71% mana arcane_charge(4), rune_of_power
3:39.634 aoe o arcane_explosion Fluffy_Pillow 49057.5/63371: 77% mana rune_of_power
3:40.940 aoe o arcane_explosion Fluffy_Pillow 45712.7/63371: 72% mana arcane_charge, rune_of_power, social_butterfly
3:42.249 aoe o arcane_explosion Fluffy_Pillow 42371.8/63371: 67% mana arcane_charge(2), clearcasting, rune_of_power, social_butterfly
3:43.553 aoe o arcane_explosion Fluffy_Pillow 44024.5/63371: 69% mana arcane_charge(3), rune_of_power, social_butterfly
3:44.860 aoe n shifting_power Fluffy_Pillow 40681.1/63371: 64% mana arcane_charge(4), social_butterfly
3:48.608 aoe p arcane_barrage Fluffy_Pillow 42931.4/63371: 68% mana arcane_charge(4)
3:49.916 aoe m arcane_orb Fluffy_Pillow 47124.0/63371: 74% mana
3:51.222 aoe p arcane_barrage Fluffy_Pillow 48279.3/63371: 76% mana arcane_charge(4), social_butterfly
3:52.529 aoe o arcane_explosion Fluffy_Pillow 52470.7/63371: 83% mana social_butterfly
3:53.836 aoe o arcane_explosion Fluffy_Pillow 49127.2/63371: 78% mana arcane_charge, social_butterfly
3:55.143 aoe o arcane_explosion Fluffy_Pillow 45783.7/63371: 72% mana arcane_charge(2)
3:56.449 aoe o arcane_explosion Fluffy_Pillow 42439.0/63371: 67% mana arcane_charge(3)
3:57.756 aoe p arcane_barrage Fluffy_Pillow 39095.5/63371: 62% mana arcane_charge(4), clearcasting
3:59.063 aoe o arcane_explosion Fluffy_Pillow 43286.9/63371: 68% mana clearcasting
4:00.371 aoe o arcane_explosion Fluffy_Pillow 44944.7/63371: 71% mana arcane_charge, social_butterfly
4:01.678 aoe o arcane_explosion Fluffy_Pillow 41601.2/63371: 66% mana arcane_charge(2), social_butterfly
4:02.983 aoe o arcane_explosion Fluffy_Pillow 38255.2/63371: 60% mana arcane_charge(3), social_butterfly
4:04.289 aoe p arcane_barrage Fluffy_Pillow 34910.5/63371: 55% mana arcane_charge(4), clearcasting, social_butterfly
4:05.596 aoe j touch_of_the_magi Fluffy_Pillow 39101.9/63371: 62% mana clearcasting
4:06.904 aoe l rune_of_power Fluffy_Pillow 38259.7/63371: 60% mana arcane_charge(4), clearcasting
4:08.212 aoe p arcane_barrage Fluffy_Pillow 39917.5/63371: 63% mana arcane_charge(4), clearcasting, rune_of_power
4:09.519 aoe o arcane_explosion Fluffy_Pillow 44108.9/63371: 70% mana clearcasting, rune_of_power
4:10.825 aoe o arcane_explosion Fluffy_Pillow 45764.1/63371: 72% mana arcane_charge, rune_of_power, social_butterfly
4:12.132 aoe o arcane_explosion Fluffy_Pillow 42420.7/63371: 67% mana arcane_charge(2), rune_of_power, social_butterfly
4:13.438 aoe o arcane_explosion Fluffy_Pillow 39075.9/63371: 62% mana arcane_charge(3), rune_of_power, social_butterfly
4:14.742 aoe p arcane_barrage Fluffy_Pillow 35728.6/63371: 56% mana arcane_charge(4), rune_of_power, social_butterfly
4:16.049 aoe m arcane_orb Fluffy_Pillow 39920.0/63371: 63% mana rune_of_power
4:17.354 aoe p arcane_barrage Fluffy_Pillow 41074.0/63371: 65% mana arcane_charge(4), rune_of_power
4:18.661 aoe o arcane_explosion Fluffy_Pillow 45265.4/63371: 71% mana rune_of_power
4:19.967 aoe o arcane_explosion Fluffy_Pillow 41920.7/63371: 66% mana arcane_charge, rune_of_power
4:21.273 aoe o arcane_explosion Fluffy_Pillow 38575.9/63371: 61% mana arcane_charge(2), social_butterfly
4:22.581 shared_cds r use_mana_gem NightFae_Dream_SB 35233.7/63371: 56% mana arcane_charge(3), social_butterfly
4:22.793 aoe o arcane_explosion Fluffy_Pillow 41839.6/63371: 66% mana arcane_charge(3), social_butterfly
4:24.098 aoe p arcane_barrage Fluffy_Pillow 38493.6/63371: 61% mana arcane_charge(4), social_butterfly
4:25.407 aoe o arcane_explosion Fluffy_Pillow 42687.5/63371: 67% mana
4:26.712 aoe o arcane_explosion Fluffy_Pillow 39341.5/63371: 62% mana arcane_charge
4:28.018 aoe o arcane_explosion Fluffy_Pillow 35996.7/63371: 57% mana arcane_charge(2)
4:29.324 aoe o arcane_explosion Fluffy_Pillow 32652.0/63371: 52% mana arcane_charge(3)
4:30.633 aoe n shifting_power Fluffy_Pillow 29311.1/63371: 46% mana arcane_charge(4), social_butterfly
4:34.169 aoe p arcane_barrage Fluffy_Pillow 31292.7/63371: 49% mana arcane_charge(4), social_butterfly
4:35.476 aoe m arcane_orb Fluffy_Pillow 35484.1/63371: 56% mana
4:36.782 aoe p arcane_barrage Fluffy_Pillow 36639.3/63371: 58% mana arcane_charge(4)
4:38.089 aoe o arcane_explosion Fluffy_Pillow 40830.7/63371: 64% mana
4:39.395 aoe o arcane_explosion Fluffy_Pillow 37486.0/63371: 59% mana arcane_charge
4:40.701 aoe o arcane_explosion Fluffy_Pillow 34141.2/63371: 54% mana arcane_charge(2), social_butterfly
4:42.009 aoe o arcane_explosion Fluffy_Pillow 30799.0/63371: 49% mana arcane_charge(3), social_butterfly
4:43.315 aoe p arcane_barrage Fluffy_Pillow 27454.3/63371: 43% mana arcane_charge(4), social_butterfly
4:44.622 aoe o arcane_explosion Fluffy_Pillow 31645.7/63371: 50% mana social_butterfly
4:45.927 aoe o arcane_explosion Fluffy_Pillow 28299.7/63371: 45% mana arcane_charge
4:47.233 aoe o arcane_explosion Fluffy_Pillow 24954.9/63371: 39% mana arcane_charge(2)
4:48.539 aoe o arcane_explosion Fluffy_Pillow 21610.2/63371: 34% mana arcane_charge(3)
4:49.845 aoe p arcane_barrage Fluffy_Pillow 18265.5/63371: 29% mana arcane_charge(4), clearcasting
4:51.152 aoe j touch_of_the_magi Fluffy_Pillow 22456.9/63371: 35% mana clearcasting, social_butterfly
4:52.458 aoe k arcane_power Fluffy_Pillow 21612.1/63371: 34% mana arcane_charge(4), clearcasting, social_butterfly
4:52.458 aoe p arcane_barrage Fluffy_Pillow 21612.1/63371: 34% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, social_butterfly
4:53.766 aoe o arcane_explosion Fluffy_Pillow 25804.8/63371: 41% mana arcane_power, clearcasting, rune_of_power, social_butterfly
4:55.073 aoe o arcane_explosion Fluffy_Pillow 27461.3/63371: 43% mana arcane_charge, arcane_power, rune_of_power
4:56.379 aoe o arcane_explosion Fluffy_Pillow 26616.6/63371: 42% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power
4:57.686 aoe o arcane_explosion Fluffy_Pillow 28273.1/63371: 45% mana arcane_charge(3), arcane_power, rune_of_power
4:58.991 aoe p arcane_barrage Fluffy_Pillow 27427.1/63371: 43% mana arcane_charge(4), arcane_power, rune_of_power
5:00.297 aoe m arcane_orb Fluffy_Pillow 31617.2/63371: 50% mana arcane_power, rune_of_power, social_butterfly
5:01.604 shared_cds s potion Fluffy_Pillow 33023.7/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly
5:01.604 aoe p arcane_barrage Fluffy_Pillow 33023.7/63371: 52% mana arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:02.910 aoe o arcane_explosion Fluffy_Pillow 37213.9/63371: 59% mana arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:04.215 aoe o arcane_explosion Fluffy_Pillow 36367.8/63371: 57% mana arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:05.523 aoe o arcane_explosion Fluffy_Pillow 35525.6/63371: 56% mana arcane_charge(2), arcane_power, potion_of_deathly_fixation
5:06.830 aoe o arcane_explosion Fluffy_Pillow 34682.2/63371: 55% mana arcane_charge(3), arcane_power, potion_of_deathly_fixation
5:08.136 aoe l rune_of_power Fluffy_Pillow 33837.4/63371: 53% mana arcane_charge(4), clearcasting, potion_of_deathly_fixation
5:09.443 aoe p arcane_barrage Fluffy_Pillow 35494.0/63371: 56% mana arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
5:10.748 aoe o arcane_explosion Fluffy_Pillow 39682.8/63371: 63% mana clearcasting, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:12.053 aoe o arcane_explosion Fluffy_Pillow 41336.8/63371: 65% mana arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
5:13.360 aoe o arcane_explosion Fluffy_Pillow 37993.3/63371: 60% mana arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:14.667 aoe o arcane_explosion Fluffy_Pillow 34649.9/63371: 55% mana arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:15.974 aoe p arcane_barrage Fluffy_Pillow 31306.4/63371: 49% mana arcane_charge(4), rune_of_power, potion_of_deathly_fixation
5:17.280 aoe o arcane_explosion Fluffy_Pillow 35496.5/63371: 56% mana rune_of_power, potion_of_deathly_fixation
5:18.587 aoe o arcane_explosion Fluffy_Pillow 32153.0/63371: 51% mana arcane_charge, rune_of_power, potion_of_deathly_fixation
5:19.893 aoe o arcane_explosion Fluffy_Pillow 28808.3/63371: 45% mana arcane_charge(2), rune_of_power, potion_of_deathly_fixation
5:21.200 aoe o arcane_explosion Fluffy_Pillow 25464.8/63371: 40% mana arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
5:22.506 aoe n shifting_power Fluffy_Pillow 22120.1/63371: 35% mana arcane_charge(4), social_butterfly, potion_of_deathly_fixation

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Niya : 17243 dps, 4694 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17242.7 17242.7 19.7 / 0.114% 1269.3 / 7.4% 9.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
1893.2 1806.9 Mana 0.00% 48.0 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 17243
Arcane Barrage 5741 33.3% 54.1 5.52sec 31556 25497 Direct 269.9 5308 10567 6323 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.06 269.87 0.00 0.00 1.2376 0.0000 1705776.55 1705776.55 0.00% 25496.65 25496.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 217.75 163 281 5307.53 2082 26100 5306.45 4847 5834 1155208 1155208 0.00%
crit 19.31% 52.12 30 78 10567.47 4164 52201 10566.34 7580 14736 550569 550569 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.07
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 476 2.8% 40.9 6.91sec 3450 0 Direct 204.7 578 1157 690 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.94 204.70 0.00 0.00 0.0000 0.0000 141255.05 141255.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 165.18 123 214 578.39 443 664 578.27 560 598 95523 95523 0.00%
crit 19.31% 39.52 21 62 1157.20 886 1329 1157.23 1054 1281 45732 45732 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7634 44.3% 141.7 2.07sec 16009 12869 Direct 708.5 2685 5368 3202 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 141.70 708.51 0.00 0.00 1.2440 0.0000 2268504.91 2268504.91 0.00% 12868.91 12868.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 571.96 448 715 2684.58 1958 4376 2684.76 2598 2747 1535526 1535526 0.00%
crit 19.27% 136.55 91 191 5367.59 3916 8751 5368.18 5004 5787 732979 732979 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:141.71
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1481) 0.0% (8.6%) 13.3 22.99sec 33064 27033

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.31 0.00 0.00 0.00 1.2231 0.0000 0.00 0.00 0.00% 27032.71 27032.71

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.31
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1481 8.6% 66.4 22.99sec 6623 0 Direct 66.4 5562 11085 6622 19.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 66.45 66.45 0.00 0.00 0.0000 0.0000 440038.47 440038.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 53.70 34 72 5562.09 3869 8695 5563.65 5117 5973 298749 298749 0.00%
crit 19.18% 12.74 3 27 11084.98 7739 17295 11087.35 8333 14799 141289 141289 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.5%) 18.3 9.05sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.5% 18.3 9.05sec 1391 0 Direct 18.3 1164 2327 1391 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.34 18.34 0.00 0.00 0.0000 0.0000 25506.35 25506.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 14.76 4 29 1163.53 1164 1164 1163.53 1164 1164 17172 17172 0.00%
crit 19.53% 3.58 0 13 2327.06 2327 2327 2264.79 0 2327 8335 8335 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1759 18.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1758.06 1758.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.27% 0.81 0 1 1480.68 1481 1481 1203.30 0 1481 1203 1203 0.00%
crit 18.73% 0.19 0 1 2961.35 2961 2961 554.76 0 2961 555 555 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5792 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5791.66 5791.66 0.00% 49.17 49.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 72.60 61 86 53.94 43 60 53.94 53 56 3916 3916 0.00%
crit 19.34% 17.40 4 29 107.81 86 120 107.79 95 120 1876 1876 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 659 3.8% 6.0 48.42sec 32591 9126 Periodic 119.6 1372 2745 1639 19.4% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 0.00 23.93 119.63 3.5714 0.8346 196039.04 196039.04 0.00% 9125.73 9125.73
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.58% 96.40 72 125 1372.31 1372 1372 1372.31 1372 1372 132286 132286 0.00%
crit 19.42% 23.23 9 43 2744.61 2745 2745 2744.61 2745 2745 63753 63753 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.01
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1141) 0.0% (6.6%) 6.6 48.83sec 51532 39443

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.57 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 39442.78 39442.78

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.60
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1141 6.6% 6.6 48.69sec 51532 0 Direct 32.7 10361 0 10361 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.57 32.70 0.00 0.00 0.0000 0.0000 338379.60 338379.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.70 25 40 10360.70 2669 51537 10370.89 8638 12979 338380 338380 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10626.31
  • base_dd_max:10626.31
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.5 97.15sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.53
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.65sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.0 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.05 0.00 0.28 0.00 4.1354 0.7173 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.05
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.39sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.46
  • if_expr:buff.arcane_power.up
Rune of Power 6.4 47.05sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.41 0.00 0.00 0.00 1.2597 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.44
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.54sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.78
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 54.8 173.2 5.4sec 1.3sec 4.1sec 75.52% 0.00% 28.5 (29.5) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.04%
  • arcane_charge_2:15.45%
  • arcane_charge_3:14.49%
  • arcane_charge_4:27.55%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.5 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.18% 23.72% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.3s
  • trigger_min/max:192.6s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.18%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 12.7sec 12.6sec 2.3sec 17.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.73%
  • clearcasting_2:0.37%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.0 0.0 0.0sec 0.0sec 4.2sec 0.07% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:0.08%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.1sec 11.15% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.15%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.9 0.0 53.5sec 16.7sec 68.2sec 84.80% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.5s / 325.5s
  • trigger_min/max:0.2s / 53.4s
  • trigger_pct:98.36%
  • duration_min/max:0.1s / 341.3s

Stack Uptimes

  • redirected_anima_1:16.54%
  • redirected_anima_2:7.63%
  • redirected_anima_3:2.32%
  • redirected_anima_4:0.50%
  • redirected_anima_5:0.09%
  • redirected_anima_6:16.48%
  • redirected_anima_7:23.94%
  • redirected_anima_8:12.14%
  • redirected_anima_9:4.05%
  • redirected_anima_10:0.94%
  • redirected_anima_11:0.21%
  • redirected_anima_12:0.05%
  • redirected_anima_13:0.02%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.9 0.0 31.1sec 31.1sec 11.8sec 39.36% 0.00% 0.0 (0.0) 9.6

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.8s
  • trigger_min/max:14.4s / 48.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.36%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.69% 0.76% 6.12% 0.9s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000201.405144.026263.962
Evocation236.537127.308340.808294.893190.880359.962
Rune of Power13.4180.33131.46089.51372.269109.087
Touch of the Magi12.2040.00021.58683.25567.986106.432
Arcane Power1.1980.0046.0594.2241.8958.956
Arcane Barrage3.0150.00312.075164.228132.681197.670
Arcane Orb4.2590.00011.66257.35040.48173.925
Shifting Power7.8570.00030.23247.46643.23557.008

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 709.40 380400.50 70.77% 536.23 7577.04 1.95%
Evocation Mana 2.28 2350.74 0.44% 1031.97 0.00 0.00%
Mana Gem Mana 2.78 18012.75 3.35% 6472.97 0.00 0.00%
Arcane Barrage Mana 54.07 136783.33 25.45% 2529.81 4739.51 3.35%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1806.87 1893.19 12323.3 36214.8 2653.0 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 141.7 524901.1 3703.9 3704.3 4.3
arcane_orb Mana 13.3 5787.6 435.0 434.9 76.0
shifting_power Mana 6.0 15037.4 2500.0 2499.9 13.0
touch_of_the_magi Mana 6.6 16431.4 2500.0 2502.3 20.6

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
NightFae_Niya Damage Per Second
Count 1121
Mean 17242.66
Minimum 16201.80
Maximum 18411.27
Spread ( max - min ) 2209.48
Range [ ( max - min ) / 2 * 100% ] 6.41%
Standard Deviation 336.7601
5th Percentile 16741.21
95th Percentile 17839.59
( 95th Percentile - 5th Percentile ) 1098.38
Mean Distribution
Standard Deviation 10.0581
95.00% Confidence Interval ( 17222.95 - 17262.38 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1466
0.1 Scale Factor Error with Delta=300 969
0.05 Scale Factor Error with Delta=300 3873
0.01 Scale Factor Error with Delta=300 96812
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1121
Mean 4694.24
Minimum 4222.79
Maximum 5179.54
Spread ( max - min ) 956.75
Range [ ( max - min ) / 2 * 100% ] 10.19%
Standard Deviation 159.3214
5th Percentile 4454.08
95th Percentile 4959.62
( 95th Percentile - 5th Percentile ) 505.54
Mean Distribution
Standard Deviation 4.7585
95.00% Confidence Interval ( 4684.92 - 4703.57 )
Normalized 95.00% Confidence Interval ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4426
0.1 Scale Factor Error with Delta=300 217
0.05 Scale Factor Error with Delta=300 867
0.01 Scale Factor Error with Delta=300 21669
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1121
Mean 17242.66
Minimum 16201.80
Maximum 18411.27
Spread ( max - min ) 2209.48
Range [ ( max - min ) / 2 * 100% ] 6.41%
Damage
NightFae_Niya Damage
Count 1121
Mean 5117258.02
Minimum 4093600.83
Maximum 6159533.23
Spread ( max - min ) 2065932.40
Range [ ( max - min ) / 2 * 100% ] 20.19%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.60 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.53 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.44 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.31 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.01 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 141.71 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.07 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.05 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.78 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.46 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooporooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpoooorpoooonpmpoooopoooopjkpoooopmspoooolpoooopoooon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Niya 63371.4/63371: 100% mana
Pre precombat R food NightFae_Niya 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.309 aoe k arcane_power Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, arcane_charge(4)
0:01.309 shared_cds s potion Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.309 shared_cds t berserking Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.309 aoe p arcane_barrage Fluffy_Pillow 60880.3/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.226 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.140 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.054 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.967 aoe o arcane_explosion Fluffy_Pillow 62448.1/63800: 98% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:05.881 aoe o arcane_explosion Fluffy_Pillow 63614.3/63800: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:06.795 aoe o arcane_explosion Fluffy_Pillow 62280.6/63800: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
0:07.708 aoe p arcane_barrage Fluffy_Pillow 61355.0/64229: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:08.623 aoe o arcane_explosion Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, berserking, arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:09.538 aoe o arcane_explosion Fluffy_Pillow 62904.0/64229: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 61580.6/64229: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:11.369 aoe o arcane_explosion Fluffy_Pillow 60256.0/64229: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:12.281 aoe p arcane_barrage Fluffy_Pillow 58927.5/64229: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:13.197 aoe o arcane_explosion Fluffy_Pillow 62673.3/64229: 98% mana bloodlust, berserking, arcane_power, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:14.112 aoe o arcane_explosion Fluffy_Pillow 61348.7/64229: 96% mana bloodlust, arcane_charge, arcane_power, redirected_anima(2), potion_of_deathly_fixation
0:15.119 aoe o arcane_explosion Fluffy_Pillow 60142.3/64229: 94% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, redirected_anima(2), potion_of_deathly_fixation
0:16.124 aoe o arcane_explosion Fluffy_Pillow 61433.3/64229: 96% mana bloodlust, arcane_charge(3), arcane_power, redirected_anima(2), potion_of_deathly_fixation
0:17.132 aoe l rune_of_power Fluffy_Pillow 60228.1/64229: 94% mana bloodlust, arcane_charge(4), redirected_anima(2), potion_of_deathly_fixation
0:18.140 aoe p arcane_barrage Fluffy_Pillow 61523.0/64229: 96% mana bloodlust, arcane_charge(4), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:19.147 aoe o arcane_explosion Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:20.155 aoe o arcane_explosion Fluffy_Pillow 60523.4/64229: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:21.160 aoe o arcane_explosion Fluffy_Pillow 61814.4/64229: 96% mana bloodlust, arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:22.166 aoe o arcane_explosion Fluffy_Pillow 58106.7/64229: 90% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:23.173 shared_cds r use_mana_gem NightFae_Niya 54400.3/64229: 85% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:23.173 aoe p arcane_barrage Fluffy_Pillow 60823.1/64229: 95% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:24.179 aoe m arcane_orb Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:25.185 aoe p arcane_barrage Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:26.191 aoe o arcane_explosion Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
0:27.199 aoe o arcane_explosion Fluffy_Pillow 64228.6/64229: 100% mana bloodlust, arcane_charge, rune_of_power, redirected_anima(2)
0:28.203 aoe o arcane_explosion Fluffy_Pillow 60518.3/64229: 94% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, redirected_anima(2)
0:29.209 aoe o arcane_explosion Fluffy_Pillow 61810.6/64229: 96% mana bloodlust, arcane_charge(3), rune_of_power, redirected_anima(2)
0:30.216 aoe n shifting_power Fluffy_Pillow 58491.8/64657: 90% mana bloodlust, arcane_charge(4), redirected_anima(3)
0:33.142 aoe p arcane_barrage Fluffy_Pillow 62152.9/67229: 92% mana bloodlust, arcane_charge(4), redirected_anima(9)
0:34.149 aoe m arcane_orb Fluffy_Pillow 65774.0/66800: 98% mana bloodlust, redirected_anima(8)
0:35.156 aoe p arcane_barrage Fluffy_Pillow 66619.3/66800: 100% mana bloodlust, arcane_charge(4), redirected_anima(8)
0:36.163 aoe o arcane_explosion Fluffy_Pillow 66800.0/66800: 100% mana bloodlust, redirected_anima(8)
0:37.171 aoe o arcane_explosion Fluffy_Pillow 62741.6/66371: 95% mana bloodlust, arcane_charge, clearcasting, redirected_anima(7)
0:38.178 aoe o arcane_explosion Fluffy_Pillow 64078.3/66371: 97% mana bloodlust, arcane_charge(2), redirected_anima(7)
0:39.183 aoe o arcane_explosion Fluffy_Pillow 60412.3/66371: 91% mana bloodlust, arcane_charge(3), redirected_anima(7)
0:40.191 aoe p arcane_barrage Fluffy_Pillow 56750.4/66371: 86% mana bloodlust, arcane_charge(4), redirected_anima(7)
0:41.198 aoe o arcane_explosion Fluffy_Pillow 60742.0/66371: 92% mana redirected_anima(7)
0:42.506 aoe o arcane_explosion Fluffy_Pillow 57478.2/66371: 87% mana arcane_charge, redirected_anima(7)
0:43.812 aoe o arcane_explosion Fluffy_Pillow 54211.9/66371: 82% mana arcane_charge(2), redirected_anima(7)
0:45.120 aoe o arcane_explosion Fluffy_Pillow 50948.1/66371: 77% mana arcane_charge(3), redirected_anima(7)
0:46.428 aoe p arcane_barrage Fluffy_Pillow 47684.4/66371: 72% mana arcane_charge(4), clearcasting, redirected_anima(7)
0:47.734 aoe o arcane_explosion Fluffy_Pillow 52072.9/66371: 78% mana clearcasting, redirected_anima(7)
0:49.039 aoe o arcane_explosion Fluffy_Pillow 53805.2/66371: 81% mana arcane_charge, redirected_anima(7)
0:50.347 aoe j touch_of_the_magi Fluffy_Pillow 50541.5/66371: 76% mana arcane_charge(2), redirected_anima(7)
0:51.654 aoe l rune_of_power Fluffy_Pillow 49776.4/66371: 75% mana arcane_charge(4), redirected_anima(7)
0:52.958 aoe p arcane_barrage Fluffy_Pillow 51507.4/66371: 78% mana arcane_charge(4), rune_of_power, redirected_anima(7)
0:54.264 aoe m arcane_orb Fluffy_Pillow 55895.9/66371: 84% mana rune_of_power, redirected_anima(7)
0:55.569 aoe p arcane_barrage Fluffy_Pillow 57128.2/66371: 86% mana arcane_charge(4), rune_of_power, redirected_anima(7)
0:56.874 aoe o arcane_explosion Fluffy_Pillow 61515.3/66371: 93% mana rune_of_power, redirected_anima(7)
0:58.180 aoe o arcane_explosion Fluffy_Pillow 58248.9/66371: 88% mana arcane_charge, rune_of_power, redirected_anima(7)
0:59.487 aoe o arcane_explosion Fluffy_Pillow 54628.8/65943: 83% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(6)
1:00.794 aoe o arcane_explosion Fluffy_Pillow 54521.4/63800: 85% mana arcane_charge(3), rune_of_power, redirected_anima
1:02.101 aoe p arcane_barrage Fluffy_Pillow 51189.1/63800: 80% mana arcane_charge(4), rune_of_power, redirected_anima
1:03.409 aoe o arcane_explosion Fluffy_Pillow 55410.1/63800: 87% mana rune_of_power, redirected_anima
1:04.714 aoe o arcane_explosion Fluffy_Pillow 52075.3/63800: 82% mana arcane_charge, rune_of_power, redirected_anima
1:06.020 aoe o arcane_explosion Fluffy_Pillow 48741.7/63800: 76% mana arcane_charge(2), redirected_anima
1:07.327 aoe o arcane_explosion Fluffy_Pillow 45409.5/63800: 71% mana arcane_charge(3), redirected_anima
1:08.633 aoe p arcane_barrage Fluffy_Pillow 42075.9/63800: 66% mana arcane_charge(4), redirected_anima
1:09.939 aoe o arcane_explosion Fluffy_Pillow 46294.4/63800: 73% mana redirected_anima
1:11.246 aoe o arcane_explosion Fluffy_Pillow 42962.1/63800: 67% mana arcane_charge, clearcasting, redirected_anima
1:12.553 aoe o arcane_explosion Fluffy_Pillow 44629.9/63800: 70% mana arcane_charge(2), redirected_anima
1:13.859 aoe o arcane_explosion Fluffy_Pillow 41296.3/63800: 65% mana arcane_charge(3), redirected_anima
1:15.165 aoe n shifting_power Fluffy_Pillow 37962.8/63800: 60% mana arcane_charge(4), redirected_anima
1:18.915 aoe p arcane_barrage Fluffy_Pillow 42140.3/66800: 63% mana arcane_charge(4), redirected_anima(8)
1:20.222 aoe m arcane_orb Fluffy_Pillow 46558.4/66800: 70% mana redirected_anima(8)
1:21.528 aoe p arcane_barrage Fluffy_Pillow 47803.3/66800: 72% mana arcane_charge(4), redirected_anima(8)
1:22.836 aoe o arcane_explosion Fluffy_Pillow 52222.8/66800: 78% mana redirected_anima(8)
1:24.140 aoe o arcane_explosion Fluffy_Pillow 48964.9/66800: 73% mana arcane_charge, redirected_anima(8)
1:25.447 aoe o arcane_explosion Fluffy_Pillow 46004.3/67229: 68% mana arcane_charge(2), redirected_anima(9)
1:26.754 aoe o arcane_explosion Fluffy_Pillow 43034.3/67657: 64% mana arcane_charge(3), clearcasting, redirected_anima(10)
1:28.060 aoe p arcane_barrage Fluffy_Pillow 44801.5/67657: 66% mana arcane_charge(4), redirected_anima(10)
1:29.367 aoe o arcane_explosion Fluffy_Pillow 49276.3/67657: 73% mana redirected_anima(10)
1:30.675 aoe o arcane_explosion Fluffy_Pillow 45754.6/67229: 68% mana arcane_charge, redirected_anima(9)
1:31.981 aoe o arcane_explosion Fluffy_Pillow 42510.6/67229: 63% mana arcane_charge(2), redirected_anima(9)
1:33.289 aoe o arcane_explosion Fluffy_Pillow 39269.3/67229: 58% mana arcane_charge(3), redirected_anima(9)
1:34.597 aoe p arcane_barrage Fluffy_Pillow 36028.0/67229: 54% mana arcane_charge(4), redirected_anima(9)
1:35.904 aoe o arcane_explosion Fluffy_Pillow 40474.5/67229: 60% mana redirected_anima(9)
1:37.211 aoe j touch_of_the_magi Fluffy_Pillow 37231.8/67229: 55% mana arcane_charge, redirected_anima(9)
1:38.518 aoe k arcane_power Fluffy_Pillow 36489.2/67229: 54% mana arcane_charge(4), redirected_anima(9)
1:38.518 aoe p arcane_barrage Fluffy_Pillow 36489.2/67229: 54% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(9)
1:39.824 aoe o arcane_explosion Fluffy_Pillow 40934.3/67229: 61% mana arcane_power, rune_of_power, redirected_anima(9)
1:41.129 aoe o arcane_explosion Fluffy_Pillow 40189.0/67229: 60% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(9)
1:42.436 aoe o arcane_explosion Fluffy_Pillow 39446.3/67229: 59% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, redirected_anima(9)
1:43.743 aoe o arcane_explosion Fluffy_Pillow 41203.7/67229: 61% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(9)
1:45.050 aoe p arcane_barrage Fluffy_Pillow 40461.1/67229: 60% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(9)
1:46.356 aoe m arcane_orb Fluffy_Pillow 43188.6/64657: 67% mana arcane_power, rune_of_power, redirected_anima(3)
1:47.663 aoe p arcane_barrage Fluffy_Pillow 44628.7/64657: 69% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(3)
1:48.969 aoe o arcane_explosion Fluffy_Pillow 48579.7/64229: 76% mana arcane_power, rune_of_power, redirected_anima(2)
1:50.276 aoe o arcane_explosion Fluffy_Pillow 47758.6/64229: 74% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(2)
1:51.584 aoe o arcane_explosion Fluffy_Pillow 46938.9/64229: 73% mana arcane_charge(2), arcane_power, redirected_anima(2)
1:52.890 aoe o arcane_explosion Fluffy_Pillow 46116.5/64229: 72% mana arcane_charge(3), arcane_power, redirected_anima(2)
1:54.198 aoe l rune_of_power Fluffy_Pillow 44994.5/63800: 71% mana arcane_charge(4), redirected_anima
1:55.505 aoe p arcane_barrage Fluffy_Pillow 46348.8/63371: 73% mana arcane_charge(4), rune_of_power
1:56.811 aoe o arcane_explosion Fluffy_Pillow 50538.9/63371: 80% mana rune_of_power
1:58.119 aoe o arcane_explosion Fluffy_Pillow 47196.7/63371: 74% mana arcane_charge, rune_of_power
1:59.427 aoe o arcane_explosion Fluffy_Pillow 43854.5/63371: 69% mana arcane_charge(2), rune_of_power
2:00.734 aoe o arcane_explosion Fluffy_Pillow 40511.0/63371: 64% mana arcane_charge(3), rune_of_power
2:02.040 aoe p arcane_barrage Fluffy_Pillow 37166.3/63371: 59% mana arcane_charge(4), clearcasting, rune_of_power
2:03.347 aoe o arcane_explosion Fluffy_Pillow 41357.6/63371: 65% mana clearcasting, rune_of_power
2:04.652 aoe o arcane_explosion Fluffy_Pillow 43011.6/63371: 68% mana arcane_charge, rune_of_power
2:05.958 aoe o arcane_explosion Fluffy_Pillow 39666.9/63371: 63% mana arcane_charge(2), rune_of_power
2:07.265 aoe o arcane_explosion Fluffy_Pillow 36323.4/63371: 57% mana arcane_charge(3), rune_of_power
2:08.571 aoe n shifting_power Fluffy_Pillow 33201.7/63800: 52% mana arcane_charge(4), redirected_anima
2:12.309 aoe p arcane_barrage Fluffy_Pillow 37139.3/66800: 56% mana arcane_charge(4), clearcasting, redirected_anima(8)
2:13.615 aoe m arcane_orb Fluffy_Pillow 41556.2/66800: 62% mana clearcasting, redirected_anima(8)
2:14.919 aoe p arcane_barrage Fluffy_Pillow 42798.3/66800: 64% mana arcane_charge(4), clearcasting, redirected_anima(8)
2:16.225 aoe o arcane_explosion Fluffy_Pillow 47215.1/66800: 71% mana clearcasting, redirected_anima(8)
2:17.530 aoe o arcane_explosion Fluffy_Pillow 48958.6/66800: 73% mana arcane_charge, redirected_anima(8)
2:18.836 aoe o arcane_explosion Fluffy_Pillow 45703.4/66800: 68% mana arcane_charge(2), redirected_anima(8)
2:20.142 aoe o arcane_explosion Fluffy_Pillow 42448.2/66800: 64% mana arcane_charge(3), clearcasting, redirected_anima(8)
2:21.449 aoe p arcane_barrage Fluffy_Pillow 44194.4/66800: 66% mana arcane_charge(4), redirected_anima(8)
2:22.756 aoe o arcane_explosion Fluffy_Pillow 48612.5/66800: 73% mana redirected_anima(8)
2:24.063 shared_cds r use_mana_gem NightFae_Niya 45358.7/66800: 68% mana arcane_charge, redirected_anima(8)
2:24.063 aoe o arcane_explosion Fluffy_Pillow 52038.7/66800: 78% mana arcane_charge, redirected_anima(8)
2:25.369 aoe o arcane_explosion Fluffy_Pillow 48783.5/66800: 73% mana arcane_charge(2), clearcasting, redirected_anima(8)
2:26.675 aoe o arcane_explosion Fluffy_Pillow 50528.3/66800: 76% mana arcane_charge(3), redirected_anima(8)
2:27.981 aoe p arcane_barrage Fluffy_Pillow 47273.1/66800: 71% mana arcane_charge(4), redirected_anima(8)
2:29.287 aoe j touch_of_the_magi Fluffy_Pillow 51690.0/66800: 77% mana redirected_anima(8)
2:30.595 aoe l rune_of_power Fluffy_Pillow 50937.4/66800: 76% mana arcane_charge(4), redirected_anima(8)
2:31.900 aoe p arcane_barrage Fluffy_Pillow 52680.9/66800: 79% mana arcane_charge(4), rune_of_power, redirected_anima(8)
2:33.207 aoe o arcane_explosion Fluffy_Pillow 57099.1/66800: 85% mana rune_of_power, redirected_anima(8)
2:34.515 aoe o arcane_explosion Fluffy_Pillow 53846.6/66800: 81% mana arcane_charge, rune_of_power, redirected_anima(8)
2:35.820 aoe o arcane_explosion Fluffy_Pillow 50590.0/66800: 76% mana arcane_charge(2), rune_of_power, redirected_anima(8)
2:37.126 aoe o arcane_explosion Fluffy_Pillow 47334.9/66800: 71% mana arcane_charge(3), rune_of_power, redirected_anima(8)
2:38.432 aoe p arcane_barrage Fluffy_Pillow 43796.9/66371: 66% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:39.738 aoe m arcane_orb Fluffy_Pillow 46007.4/63371: 73% mana rune_of_power
2:41.045 aoe p arcane_barrage Fluffy_Pillow 47163.9/63371: 74% mana arcane_charge(4), rune_of_power
2:42.352 aoe o arcane_explosion Fluffy_Pillow 51355.3/63371: 81% mana rune_of_power
2:43.659 aoe o arcane_explosion Fluffy_Pillow 48011.8/63371: 76% mana arcane_charge, rune_of_power
2:44.965 aoe o arcane_explosion Fluffy_Pillow 44667.1/63371: 70% mana arcane_charge(2)
2:46.271 aoe o arcane_explosion Fluffy_Pillow 41322.3/63371: 65% mana arcane_charge(3)
2:47.578 aoe p arcane_barrage Fluffy_Pillow 37978.9/63371: 60% mana arcane_charge(4)
2:48.886 aoe o arcane_explosion Fluffy_Pillow 42171.5/63371: 67% mana
2:50.195 aoe o arcane_explosion Fluffy_Pillow 38830.6/63371: 61% mana arcane_charge
2:51.503 aoe o arcane_explosion Fluffy_Pillow 35488.4/63371: 56% mana arcane_charge(2), clearcasting
2:52.810 aoe o arcane_explosion Fluffy_Pillow 37144.9/63371: 59% mana arcane_charge(3)
2:54.118 aoe n shifting_power Fluffy_Pillow 33802.7/63371: 53% mana arcane_charge(4)
2:57.864 aoe p arcane_barrage Fluffy_Pillow 37513.3/65943: 57% mana arcane_charge(4), redirected_anima(6)
2:59.170 aoe m arcane_orb Fluffy_Pillow 41873.5/65943: 63% mana redirected_anima(6)
3:00.477 aoe p arcane_barrage Fluffy_Pillow 43097.2/65943: 65% mana arcane_charge(4), redirected_anima(6)
3:01.783 aoe o arcane_explosion Fluffy_Pillow 47457.3/65943: 72% mana redirected_anima(6)
3:03.088 aoe o arcane_explosion Fluffy_Pillow 44178.5/65943: 67% mana arcane_charge, redirected_anima(6)
3:04.394 aoe o arcane_explosion Fluffy_Pillow 40900.9/65943: 62% mana arcane_charge(2), clearcasting, redirected_anima(6)
3:05.701 aoe o arcane_explosion Fluffy_Pillow 42624.6/65943: 65% mana arcane_charge(3), redirected_anima(6)
3:07.008 aoe p arcane_barrage Fluffy_Pillow 39348.4/65943: 60% mana arcane_charge(4), redirected_anima(6)
3:08.316 aoe o arcane_explosion Fluffy_Pillow 43711.2/65943: 66% mana redirected_anima(6)
3:09.621 aoe o arcane_explosion Fluffy_Pillow 40432.3/65943: 61% mana arcane_charge, redirected_anima(6)
3:10.927 aoe o arcane_explosion Fluffy_Pillow 37154.7/65943: 56% mana arcane_charge(2), redirected_anima(6)
3:12.234 aoe o arcane_explosion Fluffy_Pillow 33878.4/65943: 51% mana arcane_charge(3), redirected_anima(6)
3:13.540 aoe p arcane_barrage Fluffy_Pillow 30600.9/65943: 46% mana arcane_charge(4), redirected_anima(6)
3:14.847 aoe j touch_of_the_magi Fluffy_Pillow 34962.3/65943: 53% mana redirected_anima(6)
3:16.153 aoe k arcane_power Fluffy_Pillow 34184.8/65943: 52% mana arcane_charge(4), redirected_anima(6)
3:16.153 shared_cds t berserking Fluffy_Pillow 34184.8/65943: 52% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
3:16.153 aoe p arcane_barrage Fluffy_Pillow 34184.8/65943: 52% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
3:17.343 aoe o arcane_explosion Fluffy_Pillow 38391.9/65943: 58% mana berserking, arcane_power, rune_of_power, redirected_anima(6)
3:18.532 aoe o arcane_explosion Fluffy_Pillow 37460.0/65943: 57% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(6)
3:19.721 aoe o arcane_explosion Fluffy_Pillow 36528.1/65943: 55% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(6)
3:20.911 aoe o arcane_explosion Fluffy_Pillow 35597.6/65943: 54% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(6)
3:22.102 aoe p arcane_barrage Fluffy_Pillow 34668.3/65943: 53% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(6)
3:23.290 aoe m arcane_orb Fluffy_Pillow 38872.9/65943: 59% mana berserking, arcane_power, rune_of_power, redirected_anima(6)
3:24.478 aoe p arcane_barrage Fluffy_Pillow 38883.7/63800: 61% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima
3:25.666 aoe o arcane_explosion Fluffy_Pillow 42951.6/63800: 67% mana berserking, arcane_power, rune_of_power, redirected_anima
3:26.856 aoe o arcane_explosion Fluffy_Pillow 41970.0/63800: 66% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, redirected_anima
3:28.045 aoe o arcane_explosion Fluffy_Pillow 43487.2/63800: 68% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima
3:29.234 aoe o arcane_explosion Fluffy_Pillow 42504.3/63800: 67% mana arcane_charge(3), arcane_power, redirected_anima
3:30.541 aoe l rune_of_power Fluffy_Pillow 41672.1/63800: 65% mana arcane_charge(4), arcane_power, redirected_anima
3:31.846 aoe p arcane_barrage Fluffy_Pillow 43337.2/63800: 68% mana arcane_charge(4), rune_of_power, redirected_anima
3:33.152 aoe o arcane_explosion Fluffy_Pillow 47555.7/63800: 75% mana rune_of_power, redirected_anima
3:34.457 aoe o arcane_explosion Fluffy_Pillow 44220.9/63800: 69% mana arcane_charge, clearcasting, rune_of_power, redirected_anima
3:35.764 aoe o arcane_explosion Fluffy_Pillow 45888.6/63800: 72% mana arcane_charge(2), rune_of_power, redirected_anima
3:37.070 aoe o arcane_explosion Fluffy_Pillow 42555.1/63800: 67% mana arcane_charge(3), rune_of_power, redirected_anima
3:38.376 aoe p arcane_barrage Fluffy_Pillow 39221.5/63800: 61% mana arcane_charge(4), rune_of_power, redirected_anima
3:39.682 aoe o arcane_explosion Fluffy_Pillow 43731.8/64229: 68% mana rune_of_power, redirected_anima(2)
3:40.988 aoe o arcane_explosion Fluffy_Pillow 40409.4/64229: 63% mana arcane_charge, clearcasting, rune_of_power, redirected_anima(2)
3:42.295 aoe o arcane_explosion Fluffy_Pillow 42088.4/64229: 66% mana arcane_charge(2), rune_of_power, redirected_anima(2)
3:43.603 aoe o arcane_explosion Fluffy_Pillow 38768.6/64229: 60% mana arcane_charge(3), rune_of_power, redirected_anima(2)
3:44.909 aoe n shifting_power Fluffy_Pillow 35446.2/64229: 55% mana arcane_charge(4), clearcasting, redirected_anima(2)
3:48.613 aoe p arcane_barrage Fluffy_Pillow 39213.8/66800: 59% mana arcane_charge(4), clearcasting, redirected_anima(8)
3:49.918 aoe m arcane_orb Fluffy_Pillow 43629.3/66800: 65% mana clearcasting, redirected_anima(8)
3:51.223 aoe p arcane_barrage Fluffy_Pillow 44872.8/66800: 67% mana arcane_charge(4), clearcasting, redirected_anima(8)
3:52.529 aoe o arcane_explosion Fluffy_Pillow 49289.6/66800: 74% mana clearcasting, redirected_anima(8)
3:53.834 aoe o arcane_explosion Fluffy_Pillow 50705.6/66371: 76% mana arcane_charge, redirected_anima(7)
3:55.142 aoe o arcane_explosion Fluffy_Pillow 47441.9/66371: 71% mana arcane_charge(2), redirected_anima(7)
3:56.449 aoe o arcane_explosion Fluffy_Pillow 44462.1/66800: 67% mana arcane_charge(3), redirected_anima(8)
3:57.757 aoe p arcane_barrage Fluffy_Pillow 41474.0/67229: 62% mana arcane_charge(4), redirected_anima(9)
3:59.065 aoe o arcane_explosion Fluffy_Pillow 45921.8/67229: 68% mana redirected_anima(9)
4:00.373 aoe o arcane_explosion Fluffy_Pillow 42680.5/67229: 63% mana arcane_charge, redirected_anima(9)
4:01.682 aoe o arcane_explosion Fluffy_Pillow 39440.6/67229: 59% mana arcane_charge(2), redirected_anima(9)
4:02.987 aoe o arcane_explosion Fluffy_Pillow 36195.3/67229: 54% mana arcane_charge(3), clearcasting, redirected_anima(9)
4:04.293 aoe p arcane_barrage Fluffy_Pillow 37951.3/67229: 56% mana arcane_charge(4), redirected_anima(9)
4:05.598 aoe j touch_of_the_magi Fluffy_Pillow 42395.1/67229: 63% mana redirected_anima(9)
4:06.905 aoe l rune_of_power Fluffy_Pillow 41652.4/67229: 62% mana arcane_charge(4), clearcasting, redirected_anima(9)
4:08.214 aoe p arcane_barrage Fluffy_Pillow 43412.5/67229: 65% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(9)
4:09.520 aoe o arcane_explosion Fluffy_Pillow 47552.5/66800: 71% mana clearcasting, rune_of_power, redirected_anima(8)
4:10.826 aoe o arcane_explosion Fluffy_Pillow 49297.4/66800: 74% mana arcane_charge, rune_of_power, redirected_anima(8)
4:12.133 aoe o arcane_explosion Fluffy_Pillow 46043.5/66800: 69% mana arcane_charge(2), rune_of_power, redirected_anima(8)
4:13.440 aoe o arcane_explosion Fluffy_Pillow 42789.7/66800: 64% mana arcane_charge(3), rune_of_power, redirected_anima(8)
4:14.747 aoe p arcane_barrage Fluffy_Pillow 39535.8/66800: 59% mana arcane_charge(4), rune_of_power, redirected_anima(8)
4:16.055 aoe m arcane_orb Fluffy_Pillow 42263.3/64229: 66% mana rune_of_power, redirected_anima(2)
4:17.362 aoe p arcane_barrage Fluffy_Pillow 43442.2/64229: 68% mana arcane_charge(4), rune_of_power, redirected_anima(2)
4:18.668 aoe o arcane_explosion Fluffy_Pillow 47689.0/64229: 74% mana rune_of_power, redirected_anima(2)
4:19.975 aoe o arcane_explosion Fluffy_Pillow 44367.9/64229: 69% mana arcane_charge, rune_of_power, redirected_anima(2)
4:21.282 aoe o arcane_explosion Fluffy_Pillow 41046.9/64229: 64% mana arcane_charge(2), redirected_anima(2)
4:22.588 aoe o arcane_explosion Fluffy_Pillow 37724.5/64229: 59% mana arcane_charge(3), redirected_anima(2)
4:23.895 shared_cds r use_mana_gem NightFae_Niya 34403.5/64229: 54% mana arcane_charge(4), clearcasting, redirected_anima(2)
4:24.063 aoe p arcane_barrage Fluffy_Pillow 41042.1/64229: 64% mana arcane_charge(4), clearcasting, redirected_anima(2)
4:25.371 aoe o arcane_explosion Fluffy_Pillow 44989.3/63800: 71% mana clearcasting, redirected_anima
4:26.679 aoe o arcane_explosion Fluffy_Pillow 46658.3/63800: 73% mana arcane_charge, redirected_anima
4:27.986 aoe o arcane_explosion Fluffy_Pillow 43326.0/63800: 68% mana arcane_charge(2), redirected_anima
4:29.293 aoe o arcane_explosion Fluffy_Pillow 39993.7/63800: 63% mana arcane_charge(3), redirected_anima
4:30.599 aoe n shifting_power Fluffy_Pillow 36660.2/63800: 57% mana arcane_charge(4), redirected_anima
4:34.415 aoe p arcane_barrage Fluffy_Pillow 41126.8/67229: 61% mana arcane_charge(4), redirected_anima(9)
4:35.721 aoe m arcane_orb Fluffy_Pillow 45572.0/67229: 68% mana redirected_anima(9)
4:37.028 aoe p arcane_barrage Fluffy_Pillow 46829.3/67229: 70% mana arcane_charge(4), redirected_anima(9)
4:38.334 aoe o arcane_explosion Fluffy_Pillow 51274.5/67229: 76% mana redirected_anima(9)
4:39.643 aoe o arcane_explosion Fluffy_Pillow 48034.5/67229: 71% mana arcane_charge, redirected_anima(9)
4:40.949 aoe o arcane_explosion Fluffy_Pillow 44790.5/67229: 67% mana arcane_charge(2), redirected_anima(9)
4:42.257 aoe o arcane_explosion Fluffy_Pillow 41549.2/67229: 62% mana arcane_charge(3), clearcasting, redirected_anima(9)
4:43.563 aoe p arcane_barrage Fluffy_Pillow 43305.3/67229: 64% mana arcane_charge(4), redirected_anima(9)
4:44.870 aoe o arcane_explosion Fluffy_Pillow 47751.8/67229: 71% mana redirected_anima(9)
4:46.178 aoe o arcane_explosion Fluffy_Pillow 44510.4/67229: 66% mana arcane_charge, clearcasting, redirected_anima(9)
4:47.483 aoe o arcane_explosion Fluffy_Pillow 46265.1/67229: 69% mana arcane_charge(2), redirected_anima(9)
4:48.789 aoe o arcane_explosion Fluffy_Pillow 43021.1/67229: 64% mana arcane_charge(3), redirected_anima(9)
4:50.097 aoe p arcane_barrage Fluffy_Pillow 39779.8/67229: 59% mana arcane_charge(4), clearcasting, redirected_anima(9)
4:51.402 aoe j touch_of_the_magi Fluffy_Pillow 44223.6/67229: 66% mana clearcasting, redirected_anima(9)
4:52.708 aoe k arcane_power Fluffy_Pillow 43479.6/67229: 65% mana arcane_charge(4), clearcasting, redirected_anima(9)
4:52.708 aoe p arcane_barrage Fluffy_Pillow 43479.6/67229: 65% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(9)
4:54.014 aoe o arcane_explosion Fluffy_Pillow 47924.8/67229: 71% mana arcane_power, clearcasting, rune_of_power, redirected_anima(9)
4:55.320 aoe o arcane_explosion Fluffy_Pillow 49680.8/67229: 74% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(9)
4:56.625 aoe o arcane_explosion Fluffy_Pillow 48623.5/66800: 73% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(8)
4:57.932 aoe o arcane_explosion Fluffy_Pillow 47869.7/66800: 72% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(8)
4:59.239 aoe p arcane_barrage Fluffy_Pillow 47115.8/66800: 71% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
5:00.546 aoe m arcane_orb Fluffy_Pillow 51534.0/66800: 77% mana arcane_power, rune_of_power, redirected_anima(8)
5:01.852 shared_cds s potion Fluffy_Pillow 50647.3/63800: 79% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima
5:01.852 aoe p arcane_barrage Fluffy_Pillow 50647.3/63800: 79% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:03.157 aoe o arcane_explosion Fluffy_Pillow 54864.4/63800: 86% mana arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:04.464 aoe o arcane_explosion Fluffy_Pillow 54032.2/63800: 85% mana arcane_charge, arcane_power, rune_of_power, redirected_anima, potion_of_deathly_fixation
5:05.772 aoe o arcane_explosion Fluffy_Pillow 53201.2/63800: 83% mana arcane_charge(2), arcane_power, redirected_anima, potion_of_deathly_fixation
5:07.079 aoe o arcane_explosion Fluffy_Pillow 52368.9/63800: 82% mana arcane_charge(3), arcane_power, redirected_anima, potion_of_deathly_fixation
5:08.384 aoe l rune_of_power Fluffy_Pillow 51534.1/63800: 81% mana arcane_charge(4), redirected_anima, potion_of_deathly_fixation
5:09.692 aoe p arcane_barrage Fluffy_Pillow 53203.1/63800: 83% mana arcane_charge(4), rune_of_power, redirected_anima, potion_of_deathly_fixation
5:10.996 aoe o arcane_explosion Fluffy_Pillow 57419.0/63800: 90% mana rune_of_power, redirected_anima, potion_of_deathly_fixation
5:12.303 aoe o arcane_explosion Fluffy_Pillow 54450.1/64229: 85% mana arcane_charge, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:13.609 aoe o arcane_explosion Fluffy_Pillow 51127.7/64229: 80% mana arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:14.914 aoe o arcane_explosion Fluffy_Pillow 47804.1/64229: 74% mana arcane_charge(3), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:16.220 aoe p arcane_barrage Fluffy_Pillow 44481.7/64229: 69% mana arcane_charge(4), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:17.527 aoe o arcane_explosion Fluffy_Pillow 48729.8/64229: 76% mana clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:18.833 aoe o arcane_explosion Fluffy_Pillow 50407.5/64229: 78% mana arcane_charge, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:20.139 aoe o arcane_explosion Fluffy_Pillow 47085.1/64229: 73% mana arcane_charge(2), rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:21.446 aoe o arcane_explosion Fluffy_Pillow 43764.0/64229: 68% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(2), potion_of_deathly_fixation
5:22.753 aoe n shifting_power Fluffy_Pillow 45443.0/64229: 71% mana arcane_charge(4), redirected_anima(2), potion_of_deathly_fixation

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=322721//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Nadjia : 16543 dps, 4649 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16542.5 16542.5 23.7 / 0.143% 1586.0 / 9.6% 7.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2092.2 1992.7 Mana 0.00% 50.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 16543
Arcane Barrage 5701 34.5% 57.2 5.20sec 29674 24288 Direct 285.4 4974 9963 5943 19.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.15 285.37 0.00 0.00 1.2218 0.0000 1695875.88 1695875.88 0.00% 24287.86 24287.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 229.94 176 286 4974.24 2082 25140 4969.61 4433 5374 1143456 1143456 0.00%
crit 19.42% 55.43 32 88 9962.89 4164 50280 9956.88 7412 13081 552420 552420 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.15
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [r]:0.00
Arcane Echo 464 2.8% 43.3 6.45sec 3184 0 Direct 216.7 534 1067 637 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.33 216.65 0.00 0.00 0.0000 0.0000 137963.22 137963.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 174.77 123 218 533.76 316 664 532.98 499 558 93260 93260 0.00%
crit 19.33% 41.89 21 65 1067.28 633 1329 1065.92 935 1182 44703 44703 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7741 46.8% 155.2 1.89sec 14825 12178 Direct 776.0 2485 4971 2965 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.21 776.03 0.00 0.00 1.2174 0.0000 2300956.14 2300956.14 0.00% 12177.91 12177.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 626.09 487 770 2484.83 1958 4112 2484.72 2390 2571 1555561 1555561 0.00%
crit 19.32% 149.94 103 210 4971.30 3916 8223 4971.31 4603 5463 745395 745395 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:155.23
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1367) 0.0% (8.3%) 13.1 23.42sec 31115 25286

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.05 0.00 0.00 0.00 1.2306 0.0000 0.00 0.00 0.00% 25285.80 25285.80

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.05
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1367 8.3% 65.1 23.42sec 6237 0 Direct 65.1 5232 10452 6238 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.12 65.12 0.00 0.00 0.0000 0.0000 406165.85 406165.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 52.57 35 71 5231.75 3869 8126 5233.05 4708 5750 274926 274926 0.00%
crit 19.28% 12.56 2 25 10452.44 7739 16251 10456.26 8181 13543 131240 131240 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.6 1.76sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.63 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.6 1.76sec 1391 0 Direct 14.6 1164 2327 1391 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.63 14.63 0.00 0.00 0.0000 0.0000 20343.63 20343.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.47% 11.77 4 19 1163.53 1164 1164 1163.53 1164 1164 13695 13695 0.00%
crit 19.53% 2.86 0 8 2327.06 2327 2327 2227.42 0 2327 6649 6649 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1775 19.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1775.23 1775.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.11% 0.80 0 1 1480.68 1481 1481 1186.13 0 1481 1186 1186 0.00%
crit 19.89% 0.20 0 1 2961.35 2961 2961 589.10 0 2961 589 589 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5786 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5785.62 5785.62 0.00% 49.12 49.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.85% 72.76 62 85 53.90 43 60 53.90 52 56 3922 3922 0.00%
crit 19.15% 17.24 5 28 108.13 86 120 108.19 96 120 1864 1864 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (140) 0.0% (0.8%) 2.9 129.62sec 14644 11905

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 1.2302 0.0000 0.00 0.00 0.00% 11905.03 11905.03

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.87
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 70 0.4% 5.6 53.05sec 3686 0 Direct 5.6 3097 6166 3688 19.2%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.63 5.63 0.00 0.00 0.0000 0.0000 20764.13 20764.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 4.55 1 6 3097.20 1739 3651 3085.66 1739 3651 14095 14095 0.00%
crit 19.21% 1.08 0 4 6166.48 3477 7302 4273.41 0 7302 6669 6669 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 70 0.4% 2.7 132.76sec 7673 0 Direct 2.7 6402 12816 7657 19.8%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 2.74 0.00 0.00 0.0000 0.0000 20998.73 20998.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.18% 2.19 0 3 6401.75 6126 6563 6329.09 0 6563 14048 14048 0.00%
crit 19.82% 0.54 0 3 12816.29 12251 13126 5750.45 0 13126 6951 6951 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (1034) 0.0% (6.3%) 6.2 51.63sec 49910 41201

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.16 0.00 0.00 0.00 1.2114 0.0000 0.00 0.00 0.00% 41201.37 41201.37

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.18
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1034 6.3% 6.2 51.49sec 49910 0 Direct 30.8 10009 0 10009 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.16 30.75 0.00 0.00 0.0000 0.0000 307650.60 307650.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.75 25 35 10008.64 656 54382 9985.38 7165 14087 307651 307651 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:31589.37
  • base_dd_max:31589.37
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.8 127.15sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.85
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 254.21sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.1 173.85sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 6.79 0.00 4.2092 0.7049 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.14
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 49.64sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 0.00 0.00 0.00 1.2097 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.04
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 122.99sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [s]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.9 181.7 5.1sec 1.2sec 3.8sec 73.42% 0.00% 27.0 (27.6) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • arcane_charge_1:18.80%
  • arcane_charge_2:16.92%
  • arcane_charge_3:16.45%
  • arcane_charge_4:21.25%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 127.2sec 127.2sec 14.6sec 14.02% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.3s / 132.2s
  • trigger_min/max:121.3s / 132.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.02%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 254.3sec 254.3sec 11.6sec 7.18% 12.71% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:252.5s / 262.6s
  • trigger_min/max:252.5s / 262.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.18%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.2 11.7sec 11.6sec 1.9sec 15.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.82%
  • clearcasting_2:0.16%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.17% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 10.0s

Stack Uptimes

  • euphoria_1:11.17%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.1 0.0 165.6sec 165.6sec 4.2sec 1.62% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:90.7s / 265.6s
  • trigger_min/max:90.7s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 4.3s

Stack Uptimes

  • evocation_1:1.62%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.52%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.7sec 34.7sec 11.8sec 35.14% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 51.8s
  • trigger_min/max:13.5s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.14%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Thrill Seeker 4.4 143.8 78.0sec 2.0sec 66.4sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.92%
  • thrill_seeker_4:2.91%
  • thrill_seeker_5:2.88%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.83%
  • thrill_seeker_8:2.81%
  • thrill_seeker_9:2.79%
  • thrill_seeker_10:2.76%
  • thrill_seeker_11:2.74%
  • thrill_seeker_12:2.71%
  • thrill_seeker_13:2.69%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.63%
  • thrill_seeker_16:2.61%
  • thrill_seeker_17:2.59%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.55%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.51%
  • thrill_seeker_22:2.48%
  • thrill_seeker_23:2.46%
  • thrill_seeker_24:2.44%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.41%
  • thrill_seeker_27:2.40%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.37%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.35%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.33%
  • thrill_seeker_35:2.32%
  • thrill_seeker_36:2.30%
  • thrill_seeker_37:2.29%
  • thrill_seeker_38:2.28%
  • thrill_seeker_39:2.27%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 3 0.00% 0.00% 1.49%
Arcane Barrage Arcane Charge 4 100.00% 98.51% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.40% 0.77% 7.19% 0.8s 0.0s 4.9s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000177.405120.026239.962
Evocation141.5080.716350.947211.668141.359350.947
Rune of Power5.9620.06422.32037.10122.72248.282
Touch of the Magi4.7160.00019.38530.25421.41444.405
Arcane Power5.4901.31212.17515.8727.27624.893
Arcane Barrage2.7570.0008.928158.564125.805193.349
Arcane Orb3.4180.01110.48444.92232.23859.218
Mirrors of Torment24.9790.00071.47872.22466.895133.432

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 526.44 364935.71 61.57% 693.22 11390.83 3.03%
Evocation Mana 53.37 54928.44 9.27% 1029.16 0.00 0.00%
Mana Gem Mana 2.73 17272.48 2.91% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.15 138104.45 23.30% 2416.58 6758.62 4.67%
Mirrors of Torment Mana 8.38 17473.46 2.95% 2085.37 3766.27 17.73%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1992.69 2092.23 21870.5 33766.3 579.4 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_explosion Mana 155.2 594386.5 3829.0 3829.6 3.9
arcane_orb Mana 13.1 5847.6 448.0 448.0 69.5
mirrors_of_torment Mana 2.9 5708.0 2000.0 2001.5 7.3
touch_of_the_magi Mana 6.2 15404.6 2500.0 2499.1 20.0

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
Venthyr_Nadjia Damage Per Second
Count 1121
Mean 16542.51
Minimum 15263.62
Maximum 17900.23
Spread ( max - min ) 2636.61
Range [ ( max - min ) / 2 * 100% ] 7.97%
Standard Deviation 404.8193
5th Percentile 15913.88
95th Percentile 17207.89
( 95th Percentile - 5th Percentile ) 1294.01
Mean Distribution
Standard Deviation 12.0909
95.00% Confidence Interval ( 16518.81 - 16566.20 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2301
0.1 Scale Factor Error with Delta=300 1399
0.05 Scale Factor Error with Delta=300 5596
0.01 Scale Factor Error with Delta=300 139897
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1121
Mean 4649.16
Minimum 4038.56
Maximum 5300.39
Spread ( max - min ) 1261.84
Range [ ( max - min ) / 2 * 100% ] 13.57%
Standard Deviation 176.6209
5th Percentile 4375.71
95th Percentile 4949.05
( 95th Percentile - 5th Percentile ) 573.34
Mean Distribution
Standard Deviation 5.2752
95.00% Confidence Interval ( 4638.82 - 4659.50 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5545
0.1 Scale Factor Error with Delta=300 267
0.05 Scale Factor Error with Delta=300 1066
0.01 Scale Factor Error with Delta=300 26630
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1121
Mean 16542.51
Minimum 15263.62
Maximum 17900.23
Spread ( max - min ) 2636.61
Range [ ( max - min ) / 2 * 100% ] 7.97%
Damage
Venthyr_Nadjia Damage
Count 1121
Mean 4912493.41
Minimum 3796690.19
Maximum 5951937.41
Spread ( max - min ) 2155247.22
Range [ ( max - min ) / 2 * 100% ] 21.94%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.87 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.18 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.85 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.04 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.05 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 155.23 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.15 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.14 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_blast
0.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
r 0.00 arcane_barrage
actions.shared_cds
# count action,conditions
s 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkltupnpoooopoooopoooompoooospnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopoooopnspoooopoooopjkmpoooopnpoooopoooopoooopnpoooopooqkmpnpoooopoooopoooopnpoooopoooopoooopjklupnpoooospoooompoooopnpoooopoooopoooopnpoooopoooopkmpooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.313 aoe l arcane_power Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), thrill_seeker
0:02.313 shared_cds t potion Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker
0:02.313 shared_cds u berserking Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:02.313 aoe p arcane_barrage Fluffy_Pillow 60152.8/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:03.228 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:04.143 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.056 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.970 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:06.886 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:07.802 aoe o arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:08.716 aoe p arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:09.630 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:10.544 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:11.456 aoe o arcane_explosion Fluffy_Pillow 60685.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:12.370 aoe o arcane_explosion Fluffy_Pillow 59344.2/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:13.285 aoe p arcane_barrage Fluffy_Pillow 58003.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:14.198 aoe o arcane_explosion Fluffy_Pillow 61695.9/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:15.111 aoe o arcane_explosion Fluffy_Pillow 62887.9/63371: 99% mana bloodlust, arcane_charge, arcane_power, thrill_seeker(8), potion_of_deathly_fixation
0:16.117 aoe o arcane_explosion Fluffy_Pillow 61663.0/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, thrill_seeker(9), potion_of_deathly_fixation
0:17.123 aoe o arcane_explosion Fluffy_Pillow 60438.0/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, thrill_seeker(9), potion_of_deathly_fixation
0:18.130 aoe m rune_of_power Fluffy_Pillow 59214.3/63371: 93% mana bloodlust, arcane_charge(4), clearcasting, thrill_seeker(10), potion_of_deathly_fixation
0:19.135 aoe p arcane_barrage Fluffy_Pillow 60488.1/63371: 95% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(10), potion_of_deathly_fixation
0:20.142 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:21.148 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:22.153 aoe o arcane_explosion Fluffy_Pillow 59645.2/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.161 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:24.168 shared_cds s use_mana_gem Venthyr_Nadjia 52199.1/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:24.168 aoe p arcane_barrage Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:25.174 aoe n arcane_orb Fluffy_Pillow 62346.1/63371: 98% mana bloodlust, rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:26.182 aoe p arcane_barrage Fluffy_Pillow 63123.7/63371: 100% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:27.190 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:28.199 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(15)
0:29.207 aoe o arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(15)
0:30.215 aoe o arcane_explosion Fluffy_Pillow 55926.6/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(16)
0:31.221 aoe p arcane_barrage Fluffy_Pillow 52201.6/63371: 82% mana bloodlust, arcane_charge(4), thrill_seeker(16)
0:32.226 aoe o arcane_explosion Fluffy_Pillow 56010.2/63371: 88% mana bloodlust, thrill_seeker(17)
0:33.233 aoe o arcane_explosion Fluffy_Pillow 52286.5/63371: 83% mana bloodlust, arcane_charge, thrill_seeker(17)
0:34.241 aoe o arcane_explosion Fluffy_Pillow 48564.1/63371: 77% mana bloodlust, arcane_charge(2), thrill_seeker(18)
0:35.248 aoe o arcane_explosion Fluffy_Pillow 44840.4/63371: 71% mana bloodlust, arcane_charge(3), clearcasting, thrill_seeker(18)
0:36.254 aoe p arcane_barrage Fluffy_Pillow 46115.4/63371: 73% mana bloodlust, arcane_charge(4), thrill_seeker(19)
0:37.261 aoe o arcane_explosion Fluffy_Pillow 49926.6/63371: 79% mana bloodlust, thrill_seeker(19)
0:38.266 aoe o arcane_explosion Fluffy_Pillow 46200.3/63371: 73% mana bloodlust, arcane_charge, thrill_seeker(20)
0:39.275 aoe o arcane_explosion Fluffy_Pillow 42479.2/63371: 67% mana bloodlust, arcane_charge(2), thrill_seeker(20)
0:40.283 aoe o arcane_explosion Fluffy_Pillow 38756.7/63371: 61% mana bloodlust, arcane_charge(3), thrill_seeker(21)
0:41.289 aoe p arcane_barrage Fluffy_Pillow 35031.8/63371: 55% mana arcane_charge(4), thrill_seeker(21)
0:42.594 aoe o arcane_explosion Fluffy_Pillow 39220.6/63371: 62% mana thrill_seeker(22)
0:43.901 aoe o arcane_explosion Fluffy_Pillow 35877.2/63371: 57% mana arcane_charge, thrill_seeker(22)
0:45.207 aoe o arcane_explosion Fluffy_Pillow 32532.4/63371: 51% mana arcane_charge(2), clearcasting, thrill_seeker(23)
0:46.514 aoe o arcane_explosion Fluffy_Pillow 34189.0/63371: 54% mana arcane_charge(3), thrill_seeker(24)
0:47.821 aoe p arcane_barrage Fluffy_Pillow 30845.5/63371: 49% mana arcane_charge(4), thrill_seeker(24)
0:49.129 aoe n arcane_orb Fluffy_Pillow 35038.1/63371: 55% mana thrill_seeker(25)
0:50.437 aoe p arcane_barrage Fluffy_Pillow 36195.9/63371: 57% mana arcane_charge(4), thrill_seeker(26)
0:51.744 aoe o arcane_explosion Fluffy_Pillow 40387.3/63371: 64% mana thrill_seeker(26)
0:53.050 aoe o arcane_explosion Fluffy_Pillow 37042.6/63371: 58% mana arcane_charge, clearcasting, thrill_seeker(27)
0:54.358 aoe o arcane_explosion Fluffy_Pillow 38700.4/63371: 61% mana arcane_charge(2), thrill_seeker(28)
0:55.665 aoe o arcane_explosion Fluffy_Pillow 35356.9/63371: 56% mana arcane_charge(3), thrill_seeker(28)
0:56.971 aoe p arcane_barrage Fluffy_Pillow 32012.2/63371: 51% mana arcane_charge(4), thrill_seeker(29)
0:58.278 aoe o arcane_explosion Fluffy_Pillow 36203.6/63371: 57% mana thrill_seeker(30)
0:59.584 aoe o arcane_explosion Fluffy_Pillow 32858.8/63371: 52% mana arcane_charge, thrill_seeker(30)
1:00.890 aoe o arcane_explosion Fluffy_Pillow 29514.1/63371: 47% mana arcane_charge(2), thrill_seeker(31)
1:02.198 aoe o arcane_explosion Fluffy_Pillow 26171.9/63371: 41% mana arcane_charge(3), thrill_seeker(32)
1:03.504 aoe p arcane_barrage Fluffy_Pillow 22827.1/63371: 36% mana arcane_charge(4), clearcasting, thrill_seeker(32)
1:04.811 aoe k touch_of_the_magi Fluffy_Pillow 27018.5/63371: 43% mana clearcasting, thrill_seeker(33)
1:06.120 aoe m rune_of_power Fluffy_Pillow 26177.6/63371: 41% mana arcane_charge(4), clearcasting, thrill_seeker(34)
1:07.429 aoe p arcane_barrage Fluffy_Pillow 27836.7/63371: 44% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(34)
1:08.736 aoe o arcane_explosion Fluffy_Pillow 32028.0/63371: 51% mana clearcasting, rune_of_power, thrill_seeker(35)
1:10.043 aoe o arcane_explosion Fluffy_Pillow 33684.6/63371: 53% mana arcane_charge, rune_of_power, thrill_seeker(36)
1:11.349 aoe o arcane_explosion Fluffy_Pillow 30339.8/63371: 48% mana arcane_charge(2), rune_of_power, thrill_seeker(36)
1:12.655 aoe o arcane_explosion Fluffy_Pillow 26995.1/63371: 43% mana arcane_charge(3), rune_of_power, thrill_seeker(37)
1:13.961 aoe p arcane_barrage Fluffy_Pillow 23650.4/63371: 37% mana arcane_charge(4), rune_of_power, thrill_seeker(37)
1:15.267 aoe n arcane_orb Fluffy_Pillow 27840.5/63371: 44% mana rune_of_power, thrill_seeker(38)
1:16.573 aoe p arcane_barrage Fluffy_Pillow 28995.7/63371: 46% mana arcane_charge(4), rune_of_power, thrill_seeker(39)
1:17.879 aoe o arcane_explosion Fluffy_Pillow 33185.9/63371: 52% mana rune_of_power, thrill_seeker(39)
1:19.185 aoe o arcane_explosion Fluffy_Pillow 29841.1/63371: 47% mana arcane_charge, rune_of_power, euphoria
1:20.276 aoe o arcane_explosion Fluffy_Pillow 26223.9/63371: 41% mana arcane_charge(2), thrill_seeker, euphoria
1:21.366 aoe o arcane_explosion Fluffy_Pillow 22605.4/63371: 36% mana arcane_charge(3), thrill_seeker, euphoria
1:22.455 aoe p arcane_barrage Fluffy_Pillow 18985.6/63371: 30% mana arcane_charge(4), thrill_seeker(3), euphoria
1:23.543 aoe o arcane_explosion Fluffy_Pillow 22899.4/63371: 36% mana thrill_seeker(3), euphoria
1:24.634 aoe o arcane_explosion Fluffy_Pillow 19282.2/63371: 30% mana arcane_charge, thrill_seeker(4), euphoria
1:25.723 aoe o arcane_explosion Fluffy_Pillow 15662.4/63371: 25% mana arcane_charge(2), thrill_seeker(4), euphoria
1:26.813 aoe o arcane_explosion Fluffy_Pillow 12043.9/63371: 19% mana arcane_charge(3), clearcasting, thrill_seeker(5), euphoria
1:27.904 aoe p arcane_barrage Fluffy_Pillow 13426.7/63371: 21% mana arcane_charge(4), thrill_seeker(5), euphoria
1:28.993 aoe o arcane_explosion Fluffy_Pillow 17341.8/63371: 27% mana thrill_seeker(6)
1:30.300 aoe o arcane_explosion Fluffy_Pillow 13998.3/63371: 22% mana arcane_charge, thrill_seeker(7)
1:31.608 aoe o arcane_explosion Fluffy_Pillow 10656.1/63371: 17% mana arcane_charge(2), thrill_seeker(7)
1:32.912 aoe o arcane_explosion Fluffy_Pillow 7308.8/63371: 12% mana arcane_charge(3), clearcasting, thrill_seeker(8)
1:34.220 aoe p arcane_barrage Fluffy_Pillow 8966.6/63371: 14% mana arcane_charge(4), thrill_seeker(9)
1:35.525 aoe n arcane_orb Fluffy_Pillow 13155.5/63371: 21% mana thrill_seeker(9)
1:36.831 aoe p arcane_barrage Fluffy_Pillow 14310.7/63371: 23% mana arcane_charge(4), thrill_seeker(10)
1:38.136 aoe o arcane_explosion Fluffy_Pillow 18499.6/63371: 29% mana thrill_seeker(11)
1:39.444 aoe o arcane_explosion Fluffy_Pillow 15157.4/63371: 24% mana arcane_charge, clearcasting, thrill_seeker(11)
1:40.750 aoe o arcane_explosion Fluffy_Pillow 16812.6/63371: 27% mana arcane_charge(2), thrill_seeker(12)
1:42.056 aoe o arcane_explosion Fluffy_Pillow 13467.9/63371: 21% mana arcane_charge(3), thrill_seeker(13)
1:43.362 aoe p arcane_barrage Fluffy_Pillow 10123.2/63371: 16% mana arcane_charge(4), clearcasting, thrill_seeker(13)
1:44.666 aoe o arcane_explosion Fluffy_Pillow 14310.7/63371: 23% mana clearcasting, thrill_seeker(14)
1:45.975 aoe o arcane_explosion Fluffy_Pillow 15969.8/63371: 25% mana arcane_charge, thrill_seeker(14)
1:47.283 aoe o arcane_explosion Fluffy_Pillow 12627.6/63371: 20% mana arcane_charge(2), thrill_seeker(15)
1:48.589 aoe o arcane_explosion Fluffy_Pillow 9282.9/63371: 15% mana arcane_charge(3), thrill_seeker(16)
1:49.895 aoe p arcane_barrage Fluffy_Pillow 5938.1/63371: 9% mana arcane_charge(4), thrill_seeker(16)
1:51.202 aoe k touch_of_the_magi Fluffy_Pillow 10129.5/63371: 16% mana thrill_seeker(17)
1:52.508 aoe m rune_of_power Fluffy_Pillow 9284.8/63371: 15% mana arcane_charge(4), thrill_seeker(18)
1:53.813 aoe p arcane_barrage Fluffy_Pillow 10938.8/63371: 17% mana arcane_charge(4), rune_of_power, thrill_seeker(18)
1:55.120 aoe o arcane_explosion Fluffy_Pillow 15130.2/63371: 24% mana rune_of_power, thrill_seeker(19)
1:56.426 aoe o arcane_explosion Fluffy_Pillow 11785.4/63371: 19% mana arcane_charge, rune_of_power, thrill_seeker(20)
1:57.732 aoe o arcane_explosion Fluffy_Pillow 8440.7/63371: 13% mana arcane_charge(2), rune_of_power, thrill_seeker(20)
1:59.039 aoe o arcane_explosion Fluffy_Pillow 5097.2/63371: 8% mana arcane_charge(3), rune_of_power, thrill_seeker(21)
2:00.345 aoe p arcane_barrage Fluffy_Pillow 1752.5/63371: 3% mana arcane_charge(4), rune_of_power, thrill_seeker(22)
2:01.651 aoe n arcane_orb Fluffy_Pillow 5942.6/63371: 9% mana rune_of_power, thrill_seeker(22)
2:02.957 aoe p arcane_barrage Fluffy_Pillow 7097.9/63371: 11% mana arcane_charge(4), rune_of_power, thrill_seeker(23)
2:04.262 aoe o arcane_explosion Fluffy_Pillow 11286.7/63371: 18% mana rune_of_power, thrill_seeker(24)
2:05.568 aoe o arcane_explosion Fluffy_Pillow 7942.0/63371: 13% mana arcane_charge, rune_of_power, thrill_seeker(24)
2:06.874 aoe o arcane_explosion Fluffy_Pillow 4597.2/63371: 7% mana arcane_charge(2), clearcasting, thrill_seeker(25)
2:08.180 aoe o arcane_explosion Fluffy_Pillow 6252.5/63371: 10% mana arcane_charge(3), thrill_seeker(26)
2:09.486 aoe l arcane_power Fluffy_Pillow 2907.8/63371: 5% mana arcane_charge(4), thrill_seeker(26)
2:09.486 aoe p arcane_barrage Fluffy_Pillow 2907.8/63371: 5% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(26)
2:10.793 aoe o arcane_explosion Fluffy_Pillow 7099.1/63371: 11% mana arcane_power, rune_of_power, thrill_seeker(27)
2:12.100 aoe o arcane_explosion Fluffy_Pillow 6255.7/63371: 10% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(28)
2:13.404 aoe o arcane_explosion Fluffy_Pillow 5408.4/63371: 9% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(28)
2:14.710 aoe o arcane_explosion Fluffy_Pillow 4563.7/63371: 7% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, thrill_seeker(29)
2:16.016 aoe p arcane_barrage Fluffy_Pillow 6218.9/63371: 10% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(30)
2:17.323 aoe o arcane_explosion Fluffy_Pillow 10410.3/63371: 16% mana arcane_power, rune_of_power, thrill_seeker(30)
2:18.628 aoe o arcane_explosion Fluffy_Pillow 9564.3/63371: 15% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(31)
2:19.935 aoe o arcane_explosion Fluffy_Pillow 8720.8/63371: 14% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(31)
2:21.242 aoe o arcane_explosion Fluffy_Pillow 7877.4/63371: 12% mana arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(32)
2:22.547 aoe p arcane_barrage Fluffy_Pillow 7031.4/63371: 11% mana arcane_charge(4), arcane_power, thrill_seeker(33)
2:23.854 aoe n arcane_orb Fluffy_Pillow 11222.7/63371: 18% mana arcane_power, thrill_seeker(33)
2:25.160 shared_cds s use_mana_gem Venthyr_Nadjia 12628.0/63371: 20% mana arcane_charge(4), thrill_seeker(34)
2:25.160 aoe p arcane_barrage Fluffy_Pillow 18965.1/63371: 30% mana arcane_charge(4), thrill_seeker(34)
2:26.467 aoe o arcane_explosion Fluffy_Pillow 23156.5/63371: 37% mana thrill_seeker(35)
2:27.774 aoe o arcane_explosion Fluffy_Pillow 19813.1/63371: 31% mana arcane_charge, clearcasting, thrill_seeker(35)
2:29.079 aoe o arcane_explosion Fluffy_Pillow 21467.1/63371: 34% mana arcane_charge(2), thrill_seeker(36)
2:30.385 aoe o arcane_explosion Fluffy_Pillow 18122.3/63371: 29% mana arcane_charge(3), thrill_seeker(37)
2:31.692 aoe p arcane_barrage Fluffy_Pillow 14778.8/63371: 23% mana arcane_charge(4), thrill_seeker(37)
2:32.997 aoe o arcane_explosion Fluffy_Pillow 18967.7/63371: 30% mana thrill_seeker(38)
2:34.303 aoe o arcane_explosion Fluffy_Pillow 15623.0/63371: 25% mana arcane_charge, thrill_seeker(39)
2:35.609 aoe o arcane_explosion Fluffy_Pillow 12278.2/63371: 19% mana arcane_charge(2), clearcasting, thrill_seeker(39)
2:36.916 aoe o arcane_explosion Fluffy_Pillow 13934.7/63371: 22% mana arcane_charge(3), euphoria
2:38.005 aoe p arcane_barrage Fluffy_Pillow 10315.0/63371: 16% mana arcane_charge(4), thrill_seeker, euphoria
2:39.093 aoe j mirrors_of_torment Fluffy_Pillow 14228.8/63371: 22% mana thrill_seeker, euphoria
2:40.182 aoe k touch_of_the_magi Fluffy_Pillow 13609.0/63371: 21% mana thrill_seeker(3), euphoria
2:41.270 aoe m rune_of_power Fluffy_Pillow 12488.0/63371: 20% mana arcane_charge(4), thrill_seeker(3), euphoria
2:42.360 aoe p arcane_barrage Fluffy_Pillow 16404.3/63371: 26% mana arcane_charge(4), rune_of_power, thrill_seeker(4), euphoria
2:43.450 aoe o arcane_explosion Fluffy_Pillow 20320.7/63371: 32% mana rune_of_power, thrill_seeker(4), euphoria
2:44.538 aoe o arcane_explosion Fluffy_Pillow 16699.7/63371: 26% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(5), euphoria
2:45.628 aoe o arcane_explosion Fluffy_Pillow 18081.2/63371: 29% mana arcane_charge(2), rune_of_power, thrill_seeker(5), euphoria
2:46.717 aoe o arcane_explosion Fluffy_Pillow 14461.4/63371: 23% mana arcane_charge(3), rune_of_power, thrill_seeker(6)
2:48.024 aoe p arcane_barrage Fluffy_Pillow 13652.8/63371: 22% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(7)
2:49.327 aoe n arcane_orb Fluffy_Pillow 17839.1/63371: 28% mana clearcasting, rune_of_power, thrill_seeker(7)
2:50.635 aoe p arcane_barrage Fluffy_Pillow 18996.9/63371: 30% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(8)
2:51.942 aoe o arcane_explosion Fluffy_Pillow 23188.3/63371: 37% mana clearcasting, rune_of_power, thrill_seeker(8)
2:53.248 aoe o arcane_explosion Fluffy_Pillow 24843.5/63371: 39% mana arcane_charge, rune_of_power, thrill_seeker(9)
2:54.554 aoe o arcane_explosion Fluffy_Pillow 24033.7/63371: 38% mana arcane_charge(2), thrill_seeker(10)
2:55.858 aoe o arcane_explosion Fluffy_Pillow 20686.4/63371: 33% mana arcane_charge(3), clearcasting, thrill_seeker(10)
2:57.164 aoe p arcane_barrage Fluffy_Pillow 22341.6/63371: 35% mana arcane_charge(4), thrill_seeker(11)
2:58.468 aoe o arcane_explosion Fluffy_Pillow 26529.2/63371: 42% mana thrill_seeker(12)
2:59.774 aoe o arcane_explosion Fluffy_Pillow 23184.5/63371: 37% mana arcane_charge, thrill_seeker(12)
3:01.081 aoe o arcane_explosion Fluffy_Pillow 19841.0/63371: 31% mana arcane_charge(2), thrill_seeker(13)
3:02.388 aoe o arcane_explosion Fluffy_Pillow 16497.5/63371: 26% mana arcane_charge(3), thrill_seeker(14)
3:03.696 aoe p arcane_barrage Fluffy_Pillow 13155.3/63371: 21% mana arcane_charge(4), thrill_seeker(14)
3:05.002 aoe o arcane_explosion Fluffy_Pillow 17345.5/63371: 27% mana thrill_seeker(15)
3:06.309 aoe o arcane_explosion Fluffy_Pillow 14002.0/63371: 22% mana arcane_charge, thrill_seeker(16)
3:07.616 aoe o arcane_explosion Fluffy_Pillow 10658.5/63371: 17% mana arcane_charge(2), thrill_seeker(16)
3:08.921 aoe o arcane_explosion Fluffy_Pillow 7312.5/63371: 12% mana arcane_charge(3), thrill_seeker(17)
3:10.229 aoe p arcane_barrage Fluffy_Pillow 3970.3/63371: 6% mana arcane_charge(4), thrill_seeker(18)
3:11.535 aoe n arcane_orb Fluffy_Pillow 8160.4/63371: 13% mana thrill_seeker(18)
3:12.841 aoe p arcane_barrage Fluffy_Pillow 9315.7/63371: 15% mana arcane_charge(4), thrill_seeker(19)
3:14.148 aoe o arcane_explosion Fluffy_Pillow 13507.1/63371: 21% mana thrill_seeker(20)
3:15.454 aoe o arcane_explosion Fluffy_Pillow 10162.3/63371: 16% mana arcane_charge, thrill_seeker(20)
3:16.762 aoe o arcane_explosion Fluffy_Pillow 6820.1/63371: 11% mana arcane_charge(2), clearcasting, thrill_seeker(21)
3:18.068 aoe o arcane_explosion Fluffy_Pillow 8475.4/63371: 13% mana arcane_charge(3), thrill_seeker(22)
3:19.376 aoe p arcane_barrage Fluffy_Pillow 5133.2/63371: 8% mana arcane_charge(4), thrill_seeker(22)
3:20.682 aoe o arcane_explosion Fluffy_Pillow 9323.3/63371: 15% mana thrill_seeker(23)
3:21.990 aoe o arcane_explosion Fluffy_Pillow 5981.1/63371: 9% mana arcane_charge, thrill_seeker(23)
3:23.297 aoe q evocation Venthyr_Nadjia 2637.6/63371: 4% mana arcane_charge(2), thrill_seeker(24)
3:27.642 aoe k touch_of_the_magi Fluffy_Pillow 56483.6/63371: 89% mana arcane_charge(2), thrill_seeker(26)
3:28.949 aoe m rune_of_power Fluffy_Pillow 55640.1/63371: 88% mana arcane_charge(4), thrill_seeker(27)
3:30.256 aoe p arcane_barrage Fluffy_Pillow 57296.6/63371: 90% mana arcane_charge(4), rune_of_power, thrill_seeker(28)
3:31.562 aoe n arcane_orb Fluffy_Pillow 61486.7/63371: 97% mana rune_of_power, thrill_seeker(28)
3:32.869 aoe p arcane_barrage Fluffy_Pillow 62643.3/63371: 99% mana arcane_charge(4), rune_of_power, thrill_seeker(29)
3:34.176 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(30)
3:35.482 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power, thrill_seeker(30)
3:36.789 aoe o arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), rune_of_power, thrill_seeker(31)
3:38.095 aoe o arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), rune_of_power, thrill_seeker(32)
3:39.400 aoe p arcane_barrage Fluffy_Pillow 49992.5/63371: 79% mana arcane_charge(4), rune_of_power, thrill_seeker(32)
3:40.707 aoe o arcane_explosion Fluffy_Pillow 54183.9/63371: 86% mana rune_of_power, thrill_seeker(33)
3:42.014 aoe o arcane_explosion Fluffy_Pillow 50840.4/63371: 80% mana arcane_charge, rune_of_power, thrill_seeker(34)
3:43.319 aoe o arcane_explosion Fluffy_Pillow 47494.4/63371: 75% mana arcane_charge(2), clearcasting, thrill_seeker(34)
3:44.624 aoe o arcane_explosion Fluffy_Pillow 49148.4/63371: 78% mana arcane_charge(3), thrill_seeker(35)
3:45.930 aoe p arcane_barrage Fluffy_Pillow 45803.6/63371: 72% mana arcane_charge(4), thrill_seeker(35)
3:47.236 aoe o arcane_explosion Fluffy_Pillow 49993.8/63371: 79% mana thrill_seeker(36)
3:48.544 aoe o arcane_explosion Fluffy_Pillow 46651.6/63371: 74% mana arcane_charge, thrill_seeker(37)
3:49.850 aoe o arcane_explosion Fluffy_Pillow 43306.8/63371: 68% mana arcane_charge(2), clearcasting, thrill_seeker(37)
3:51.156 aoe o arcane_explosion Fluffy_Pillow 44962.1/63371: 71% mana arcane_charge(3), thrill_seeker(38)
3:52.462 aoe p arcane_barrage Fluffy_Pillow 41617.3/63371: 66% mana arcane_charge(4), thrill_seeker(39)
3:53.768 aoe n arcane_orb Fluffy_Pillow 45807.5/63371: 72% mana thrill_seeker(39)
3:55.076 aoe p arcane_barrage Fluffy_Pillow 46965.3/63371: 74% mana arcane_charge(4), euphoria
3:56.165 aoe o arcane_explosion Fluffy_Pillow 50880.3/63371: 80% mana thrill_seeker, euphoria
3:57.256 aoe o arcane_explosion Fluffy_Pillow 47263.1/63371: 75% mana arcane_charge, thrill_seeker, euphoria
3:58.345 aoe o arcane_explosion Fluffy_Pillow 43643.3/63371: 69% mana arcane_charge(2), thrill_seeker(3), euphoria
3:59.436 aoe o arcane_explosion Fluffy_Pillow 40026.1/63371: 63% mana arcane_charge(3), thrill_seeker(3), euphoria
4:00.525 aoe p arcane_barrage Fluffy_Pillow 36406.3/63371: 57% mana arcane_charge(4), thrill_seeker(4), euphoria
4:01.614 aoe o arcane_explosion Fluffy_Pillow 40321.4/63371: 64% mana thrill_seeker(4), euphoria
4:02.704 aoe o arcane_explosion Fluffy_Pillow 36702.9/63371: 58% mana arcane_charge, thrill_seeker(5), euphoria
4:03.793 aoe o arcane_explosion Fluffy_Pillow 33083.1/63371: 52% mana arcane_charge(2), thrill_seeker(5), euphoria
4:04.883 aoe o arcane_explosion Fluffy_Pillow 29464.6/63371: 46% mana arcane_charge(3), clearcasting, thrill_seeker(6)
4:06.189 aoe p arcane_barrage Fluffy_Pillow 31119.9/63371: 49% mana arcane_charge(4), thrill_seeker(7)
4:07.496 aoe o arcane_explosion Fluffy_Pillow 35311.3/63371: 56% mana thrill_seeker(7)
4:08.803 aoe o arcane_explosion Fluffy_Pillow 31967.8/63371: 50% mana arcane_charge, clearcasting, thrill_seeker(8)
4:10.108 aoe o arcane_explosion Fluffy_Pillow 33621.8/63371: 53% mana arcane_charge(2), thrill_seeker(9)
4:11.412 aoe o arcane_explosion Fluffy_Pillow 30274.5/63371: 48% mana arcane_charge(3), thrill_seeker(9)
4:12.717 aoe p arcane_barrage Fluffy_Pillow 26928.5/63371: 42% mana arcane_charge(4), thrill_seeker(10)
4:14.023 aoe j mirrors_of_torment Fluffy_Pillow 31118.7/63371: 49% mana thrill_seeker(11)
4:15.330 aoe k touch_of_the_magi Fluffy_Pillow 30775.2/63371: 49% mana clearcasting, thrill_seeker(11)
4:16.637 aoe l arcane_power Fluffy_Pillow 29931.7/63371: 47% mana arcane_charge(4), clearcasting, thrill_seeker(12)
4:16.637 shared_cds u berserking Fluffy_Pillow 29931.7/63371: 47% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(12)
4:16.637 aoe p arcane_barrage Fluffy_Pillow 29931.7/63371: 47% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(12)
4:17.823 aoe n arcane_orb Fluffy_Pillow 36504.6/63371: 58% mana berserking, arcane_power, clearcasting, rune_of_power, thrill_seeker(12)
4:19.011 aoe p arcane_barrage Fluffy_Pillow 37760.3/63371: 60% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, thrill_seeker(13)
4:20.200 aoe o arcane_explosion Fluffy_Pillow 41802.1/63371: 66% mana berserking, arcane_power, clearcasting, rune_of_power, thrill_seeker(14)
4:21.389 aoe o arcane_explosion Fluffy_Pillow 43309.1/63371: 68% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(14)
4:22.580 aoe o arcane_explosion Fluffy_Pillow 42318.6/63371: 67% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(15)
4:23.768 aoe o arcane_explosion Fluffy_Pillow 43859.2/63371: 69% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, thrill_seeker(15)
4:24.956 shared_cds s use_mana_gem Venthyr_Nadjia 45364.9/63371: 72% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(16)
4:25.160 aoe p arcane_barrage Fluffy_Pillow 51960.6/63371: 82% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(16)
4:26.348 aoe o arcane_explosion Fluffy_Pillow 56001.1/63371: 88% mana berserking, arcane_power, rune_of_power, thrill_seeker(17)
4:27.535 aoe o arcane_explosion Fluffy_Pillow 55005.6/63371: 87% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(17)
4:28.723 aoe o arcane_explosion Fluffy_Pillow 54011.3/63371: 85% mana arcane_charge(2), arcane_power, thrill_seeker(18)
4:30.028 aoe o arcane_explosion Fluffy_Pillow 55700.1/63371: 88% mana arcane_charge(3), arcane_power, thrill_seeker(19)
4:31.335 aoe m rune_of_power Fluffy_Pillow 54856.7/63371: 87% mana arcane_charge(4), arcane_power, thrill_seeker(19)
4:32.639 aoe p arcane_barrage Fluffy_Pillow 56509.4/63371: 89% mana arcane_charge(4), rune_of_power, thrill_seeker(20)
4:33.944 aoe o arcane_explosion Fluffy_Pillow 60698.2/63371: 96% mana rune_of_power, thrill_seeker(20)
4:35.250 aoe o arcane_explosion Fluffy_Pillow 57353.5/63371: 91% mana arcane_charge, rune_of_power, thrill_seeker(21)
4:36.558 aoe o arcane_explosion Fluffy_Pillow 54011.3/63371: 85% mana arcane_charge(2), rune_of_power, thrill_seeker(22)
4:37.862 aoe o arcane_explosion Fluffy_Pillow 50664.0/63371: 80% mana arcane_charge(3), rune_of_power, thrill_seeker(22)
4:39.168 aoe p arcane_barrage Fluffy_Pillow 47319.3/63371: 75% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(23)
4:40.476 aoe n arcane_orb Fluffy_Pillow 51511.9/63371: 81% mana clearcasting, rune_of_power, thrill_seeker(24)
4:41.781 aoe p arcane_barrage Fluffy_Pillow 52665.9/63371: 83% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(24)
4:43.088 aoe o arcane_explosion Fluffy_Pillow 56857.3/63371: 90% mana clearcasting, rune_of_power, thrill_seeker(25)
4:44.395 aoe o arcane_explosion Fluffy_Pillow 58513.9/63371: 92% mana arcane_charge, rune_of_power, thrill_seeker(26)
4:45.699 aoe o arcane_explosion Fluffy_Pillow 55166.6/63371: 87% mana arcane_charge(2), thrill_seeker(26)
4:47.006 aoe o arcane_explosion Fluffy_Pillow 51823.1/63371: 82% mana arcane_charge(3), clearcasting, thrill_seeker(27)
4:48.312 aoe p arcane_barrage Fluffy_Pillow 53478.4/63371: 84% mana arcane_charge(4), thrill_seeker(28)
4:49.619 aoe o arcane_explosion Fluffy_Pillow 57669.8/63371: 91% mana thrill_seeker(28)
4:50.925 aoe o arcane_explosion Fluffy_Pillow 54325.0/63371: 86% mana arcane_charge, clearcasting, thrill_seeker(29)
4:52.233 aoe o arcane_explosion Fluffy_Pillow 55982.8/63371: 88% mana arcane_charge(2), thrill_seeker(30)
4:53.540 aoe o arcane_explosion Fluffy_Pillow 52639.3/63371: 83% mana arcane_charge(3), thrill_seeker(30)
4:54.847 aoe p arcane_barrage Fluffy_Pillow 49295.9/63371: 78% mana arcane_charge(4), thrill_seeker(31)
4:56.153 aoe o arcane_explosion Fluffy_Pillow 53486.0/63371: 84% mana thrill_seeker(32)
4:57.459 aoe o arcane_explosion Fluffy_Pillow 50141.3/63371: 79% mana arcane_charge, clearcasting, thrill_seeker(32)
4:58.766 aoe o arcane_explosion Fluffy_Pillow 51797.8/63371: 82% mana arcane_charge(2), thrill_seeker(33)
5:00.074 aoe o arcane_explosion Fluffy_Pillow 48455.6/63371: 76% mana arcane_charge(3), thrill_seeker(34)
5:01.380 aoe p arcane_barrage Fluffy_Pillow 45110.8/63371: 71% mana arcane_charge(4), thrill_seeker(34)
5:02.686 aoe n arcane_orb Fluffy_Pillow 49301.0/63371: 78% mana thrill_seeker(35)
5:03.993 aoe p arcane_barrage Fluffy_Pillow 50457.5/63371: 80% mana arcane_charge(4), thrill_seeker(35)
5:05.300 aoe o arcane_explosion Fluffy_Pillow 54648.9/63371: 86% mana thrill_seeker(36)
5:06.607 aoe o arcane_explosion Fluffy_Pillow 51305.4/63371: 81% mana arcane_charge, thrill_seeker(37)
5:07.915 aoe o arcane_explosion Fluffy_Pillow 47963.2/63371: 76% mana arcane_charge(2), thrill_seeker(37)
5:09.221 aoe o arcane_explosion Fluffy_Pillow 44618.5/63371: 70% mana arcane_charge(3), clearcasting, thrill_seeker(38)
5:10.527 aoe p arcane_barrage Fluffy_Pillow 46273.7/63371: 73% mana arcane_charge(4), thrill_seeker(39)
5:11.835 aoe o arcane_explosion Fluffy_Pillow 50466.4/63371: 80% mana thrill_seeker(39)
5:13.143 aoe o arcane_explosion Fluffy_Pillow 47124.2/63371: 74% mana arcane_charge, euphoria
5:14.233 aoe o arcane_explosion Fluffy_Pillow 43505.7/63371: 69% mana arcane_charge(2), clearcasting, thrill_seeker, euphoria
5:15.323 aoe o arcane_explosion Fluffy_Pillow 44887.2/63371: 71% mana arcane_charge(3), thrill_seeker, euphoria
5:16.413 aoe p arcane_barrage Fluffy_Pillow 41268.7/63371: 65% mana arcane_charge(4), thrill_seeker(3), euphoria
5:17.502 aoe k touch_of_the_magi Fluffy_Pillow 45183.8/63371: 71% mana thrill_seeker(3), euphoria
5:18.592 aoe m rune_of_power Fluffy_Pillow 44065.3/63371: 70% mana arcane_charge(4), thrill_seeker(4), euphoria
5:19.681 aoe p arcane_barrage Fluffy_Pillow 45445.5/63371: 72% mana arcane_charge(4), rune_of_power, thrill_seeker(4), euphoria
5:20.770 aoe o arcane_explosion Fluffy_Pillow 49360.6/63371: 78% mana rune_of_power, thrill_seeker(5), euphoria
5:21.860 aoe o arcane_explosion Fluffy_Pillow 45742.1/63371: 72% mana arcane_charge, rune_of_power, thrill_seeker(5), euphoria
5:22.950 aoe o arcane_explosion Fluffy_Pillow 42123.6/63371: 66% mana arcane_charge(2), rune_of_power, thrill_seeker(6)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=331586//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Theotar : 16584 dps, 4647 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16584.3 16584.3 25.0 / 0.151% 1628.6 / 9.8% 8.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2050.6 1963.0 Mana 0.00% 49.6 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 16584
Arcane Barrage 5704 34.4% 56.5 5.26sec 30028 24073 Direct 282.4 5042 10078 6015 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.54 282.36 0.00 0.00 1.2474 0.0000 1697721.21 1697721.21 0.00% 24072.96 24072.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 227.84 176 291 5041.89 2082 26974 5034.88 4515 5590 1148445 1148445 0.00%
crit 19.31% 54.51 30 89 10078.00 4164 53948 10064.39 7689 13624 549276 549276 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:56.54
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 456 2.7% 42.7 6.55sec 3173 0 Direct 213.6 532 1063 635 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.71 213.55 0.00 0.00 0.0000 0.0000 135524.94 135524.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 172.09 117 214 531.71 316 664 530.97 497 566 91486 91486 0.00%
crit 19.42% 41.46 21 63 1062.64 633 1329 1060.85 938 1208 44039 44039 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7751 46.7% 152.3 1.92sec 15128 12182 Direct 761.6 2537 5068 3026 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 152.31 761.56 0.00 0.00 1.2418 0.0000 2304158.90 2304158.90 0.00% 12181.84 12181.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 614.31 477 761 2536.84 1958 4616 2536.50 2437 2656 1558153 1558153 0.00%
crit 19.33% 147.25 99 203 5067.70 3916 9232 5066.11 4685 5537 746006 746006 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:152.33
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1391) 0.0% (8.4%) 13.0 23.49sec 31760 25477

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.03 0.00 0.00 0.00 1.2466 0.0000 0.00 0.00 0.00% 25477.46 25477.46

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.03
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1391 8.4% 65.0 23.49sec 6365 0 Direct 65.0 5346 10719 6366 19.0%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.00 65.00 0.00 0.00 0.0000 0.0000 413753.92 413753.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.03% 52.67 37 71 5346.41 3869 9122 5342.47 4753 5982 281551 281551 0.00%
crit 18.97% 12.33 3 24 10718.96 7739 18245 10721.65 7739 14024 132203 132203 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (70) 0.0% (0.4%) 14.9 1.73sec 1387 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 70 0.4% 14.9 1.73sec 1387 0 Direct 14.9 1164 2327 1387 19.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.88 14.88 0.00 0.00 0.0000 0.0000 20643.60 20643.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 12.02 4 18 1163.53 1164 1164 1163.53 1164 1164 13982 13982 0.00%
crit 19.24% 2.86 0 10 2327.06 2327 2327 2219.12 0 2327 6662 6662 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1787 20.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1785.79 1785.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.39% 0.79 0 1 1480.68 1481 1481 1175.56 0 1481 1176 1176 0.00%
crit 20.61% 0.21 0 1 2961.35 2961 2961 610.23 0 2961 610 610 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5799 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5799.24 5799.24 0.00% 49.24 49.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.50% 72.45 61 86 53.94 43 60 53.94 53 56 3908 3908 0.00%
crit 19.50% 17.55 4 29 107.77 86 120 107.81 95 120 1891 1891 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (129) 0.0% (0.8%) 2.7 139.35sec 14425 11042

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.66 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 11041.98 11041.98

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.67
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 63 0.4% 5.2 55.61sec 3606 0 Direct 5.2 3033 6078 3610 18.8%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.24 5.24 0.00 0.00 0.0000 0.0000 18911.42 18911.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 4.26 1 6 3033.30 1739 3651 3018.05 1739 3651 12908 12908 0.00%
crit 18.81% 0.99 0 5 6077.59 3477 7302 3977.35 0 7302 6004 6004 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 65 0.4% 2.6 141.36sec 7623 0 Direct 2.6 6388 12801 7611 19.3%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.55 2.55 0.00 0.00 0.0000 0.0000 19448.41 19448.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 2.06 0 3 6387.69 6126 6563 6252.33 0 6563 13157 13157 0.00%
crit 19.27% 0.49 0 3 12800.77 12251 13126 5367.30 0 13126 6292 6292 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (1057) 0.0% (6.4%) 6.1 52.73sec 51846 41249

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2569 0.0000 0.00 0.00 0.00% 41248.97 41248.97

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.08
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1057 6.4% 6.1 52.60sec 51846 0 Direct 30.2 10391 0 10391 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 30.23 0.00 0.00 0.0000 0.0000 313945.87 313945.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.23 25 35 10391.44 360 54396 10387.69 6779 13601 313946 313946 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35750.02
  • base_dd_max:35750.02
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 129.27sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.81
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.57sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.81
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 162.63sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.81 0.00 4.83 0.00 4.2955 0.7218 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.81
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.9 50.70sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.92 0.00 0.00 0.00 1.2558 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:5.94
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.49sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.68 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.69
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.3 179.1 5.2sec 1.2sec 3.8sec 72.86% 0.00% 26.4 (26.5) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.65%
  • arcane_charge_2:16.30%
  • arcane_charge_3:16.42%
  • arcane_charge_4:21.49%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.2sec 129.2sec 14.7sec 13.84% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 135.2s
  • trigger_min/max:121.7s / 135.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.84%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.4sec 258.4sec 11.7sec 7.04% 23.43% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:248.4s / 264.3s
  • trigger_min/max:248.4s / 264.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.04%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.1 0.2 11.9sec 11.8sec 2.0sec 16.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.03%
  • clearcasting_2:0.20%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.8 0.0 162.8sec 162.8sec 4.3sec 1.18% 0.00% 3.2 (3.2) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:99.7s / 244.8s
  • trigger_min/max:99.7s / 244.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.18%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.52%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 35.3sec 35.3sec 11.8sec 34.57% 0.00% 0.0 (0.0) 8.4

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.4s / 56.6s
  • trigger_min/max:13.4s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.57%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 61.6sec 61.6sec 11.8sec 16.49% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 218.4s
  • trigger_min/max:20.0s / 218.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.49%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.77% 0.80% 7.29% 0.8s 0.0s 6.0s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000177.405120.026239.962
Evocation181.0789.721352.280239.602150.798357.283
Rune of Power6.8251.13824.69041.81426.61958.369
Touch of the Magi5.5910.00020.81235.29325.31355.981
Arcane Power6.7331.67715.18119.4034.02826.627
Arcane Barrage2.7620.0039.580157.289124.760192.993
Arcane Orb3.4710.00010.48545.54035.04659.851
Mirrors of Torment29.5180.00074.71085.46659.925138.421

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 516.28 372203.70 63.74% 720.94 12953.01 3.36%
Evocation Mana 38.70 39422.22 6.75% 1018.66 0.00 0.00%
Mana Gem Mana 2.69 17346.30 2.97% 6451.67 0.00 0.00%
Arcane Barrage Mana 56.54 138980.74 23.80% 2457.94 7617.54 5.20%
Mirrors of Torment Mana 7.80 15979.65 2.74% 2048.12 4237.05 20.96%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1963.05 2050.58 24779.1 36632.7 763.8 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 152.3 582607.7 3824.6 3825.1 4.0
arcane_orb Mana 13.0 5850.3 449.1 449.1 70.7
mirrors_of_torment Mana 2.7 5321.0 2000.0 2001.0 7.2
touch_of_the_magi Mana 6.1 15136.3 2500.0 2499.7 20.7

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
Venthyr_Theotar Damage Per Second
Count 1121
Mean 16584.30
Minimum 15099.69
Maximum 17877.28
Spread ( max - min ) 2777.59
Range [ ( max - min ) / 2 * 100% ] 8.37%
Standard Deviation 427.1009
5th Percentile 15898.74
95th Percentile 17286.98
( 95th Percentile - 5th Percentile ) 1388.24
Mean Distribution
Standard Deviation 12.7564
95.00% Confidence Interval ( 16559.29 - 16609.30 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2548
0.1 Scale Factor Error with Delta=300 1558
0.05 Scale Factor Error with Delta=300 6229
0.01 Scale Factor Error with Delta=300 155721
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1121
Mean 4646.52
Minimum 3995.15
Maximum 5198.64
Spread ( max - min ) 1203.49
Range [ ( max - min ) / 2 * 100% ] 12.95%
Standard Deviation 178.4179
5th Percentile 4379.30
95th Percentile 4956.35
( 95th Percentile - 5th Percentile ) 577.05
Mean Distribution
Standard Deviation 5.3289
95.00% Confidence Interval ( 4636.07 - 4656.96 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5664
0.1 Scale Factor Error with Delta=300 272
0.05 Scale Factor Error with Delta=300 1087
0.01 Scale Factor Error with Delta=300 27175
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1121
Mean 16584.30
Minimum 15099.69
Maximum 17877.28
Spread ( max - min ) 2777.59
Range [ ( max - min ) / 2 * 100% ] 8.37%
Damage
Venthyr_Theotar Damage
Count 1121
Mean 4925894.07
Minimum 3772193.50
Maximum 6018662.00
Spread ( max - min ) 2246468.50
Range [ ( max - min ) / 2 * 100% ] 22.80%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.67 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.08 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.81 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 5.94 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.03 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 152.33 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 56.54 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.81 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.69 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.81 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooopnpoooropoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopoooopnpooroopoooopjkmpnpoooopoooopoooopnpoooopoooopooqkmpnpoooopoooopoooopnpoooopoooopoooopjkltpnpoooopoooompoooorpnpoooopoooopoooopnpoooopoooop

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k touch_of_the_magi Fluffy_Pillow 61375.2/63371: 97% mana bloodlust, clearcasting
0:02.312 aoe l arcane_power Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), clearcasting
0:02.312 shared_cds s potion Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:02.312 shared_cds t berserking Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.312 aoe p arcane_barrage Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.226 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.140 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.053 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:05.967 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.881 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.797 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.711 aoe p arcane_barrage Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.625 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.538 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.450 aoe o arcane_explosion Fluffy_Pillow 60684.5/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.364 aoe o arcane_explosion Fluffy_Pillow 59342.9/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.279 aoe p arcane_barrage Fluffy_Pillow 58002.6/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.193 aoe o arcane_explosion Fluffy_Pillow 61695.9/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.108 aoe o arcane_explosion Fluffy_Pillow 62890.5/63371: 99% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:16.112 aoe o arcane_explosion Fluffy_Pillow 61663.0/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:17.119 aoe o arcane_explosion Fluffy_Pillow 60439.3/63371: 95% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, potion_of_deathly_fixation
0:18.124 aoe m rune_of_power Fluffy_Pillow 61713.0/63371: 97% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.128 aoe p arcane_barrage Fluffy_Pillow 62985.5/63371: 99% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.133 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.140 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:22.146 aoe o arcane_explosion Fluffy_Pillow 60922.8/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.152 aoe o arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.161 aoe p arcane_barrage Fluffy_Pillow 58476.6/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.166 aoe n arcane_orb Fluffy_Pillow 62285.3/63371: 98% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.173 aoe p arcane_barrage Fluffy_Pillow 63061.6/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.179 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.185 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.191 aoe o arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.198 shared_cds r use_mana_gem Venthyr_Theotar 52197.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.198 aoe o arcane_explosion Fluffy_Pillow 58534.9/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power
0:31.205 aoe p arcane_barrage Fluffy_Pillow 54811.2/63371: 86% mana bloodlust, arcane_charge(4)
0:32.211 aoe o arcane_explosion Fluffy_Pillow 58621.1/63371: 93% mana bloodlust
0:33.218 aoe o arcane_explosion Fluffy_Pillow 54897.4/63371: 87% mana bloodlust, arcane_charge
0:34.224 aoe o arcane_explosion Fluffy_Pillow 51172.5/63371: 81% mana bloodlust, arcane_charge(2)
0:35.228 aoe o arcane_explosion Fluffy_Pillow 47445.0/63371: 75% mana bloodlust, arcane_charge(3)
0:36.235 aoe p arcane_barrage Fluffy_Pillow 43721.3/63371: 69% mana bloodlust, arcane_charge(4)
0:37.242 aoe o arcane_explosion Fluffy_Pillow 47532.4/63371: 75% mana bloodlust
0:38.249 aoe o arcane_explosion Fluffy_Pillow 43808.7/63371: 69% mana bloodlust, arcane_charge
0:39.252 aoe o arcane_explosion Fluffy_Pillow 40080.0/63371: 63% mana bloodlust, arcane_charge(2)
0:40.257 aoe o arcane_explosion Fluffy_Pillow 36353.7/63371: 57% mana bloodlust, arcane_charge(3)
0:41.264 aoe p arcane_barrage Fluffy_Pillow 32630.0/63371: 51% mana arcane_charge(4)
0:42.571 aoe o arcane_explosion Fluffy_Pillow 36821.4/63371: 58% mana
0:43.877 aoe o arcane_explosion Fluffy_Pillow 33476.7/63371: 53% mana arcane_charge, clearcasting
0:45.182 aoe o arcane_explosion Fluffy_Pillow 35130.7/63371: 55% mana arcane_charge(2)
0:46.488 aoe o arcane_explosion Fluffy_Pillow 31785.9/63371: 50% mana arcane_charge(3), clearcasting
0:47.794 aoe p arcane_barrage Fluffy_Pillow 33441.2/63371: 53% mana arcane_charge(4)
0:49.098 aoe n arcane_orb Fluffy_Pillow 37628.8/63371: 59% mana
0:50.405 aoe p arcane_barrage Fluffy_Pillow 38785.3/63371: 61% mana arcane_charge(4)
0:51.712 aoe o arcane_explosion Fluffy_Pillow 42976.7/63371: 68% mana
0:53.018 aoe o arcane_explosion Fluffy_Pillow 39631.9/63371: 63% mana arcane_charge
0:54.325 aoe o arcane_explosion Fluffy_Pillow 36288.5/63371: 57% mana arcane_charge(2)
0:55.634 aoe o arcane_explosion Fluffy_Pillow 32947.5/63371: 52% mana arcane_charge(3)
0:56.941 aoe p arcane_barrage Fluffy_Pillow 29604.1/63371: 47% mana arcane_charge(4)
0:58.246 aoe o arcane_explosion Fluffy_Pillow 33792.9/63371: 53% mana
0:59.554 aoe o arcane_explosion Fluffy_Pillow 30450.7/63371: 48% mana arcane_charge, clearcasting
1:00.860 aoe o arcane_explosion Fluffy_Pillow 32106.0/63371: 51% mana arcane_charge(2)
1:02.168 aoe o arcane_explosion Fluffy_Pillow 32848.8/72371: 45% mana arcane_charge(3), soothing_shade
1:03.476 aoe p arcane_barrage Fluffy_Pillow 29742.0/72371: 41% mana arcane_charge(4), soothing_shade
1:04.783 aoe k touch_of_the_magi Fluffy_Pillow 34528.7/72371: 48% mana soothing_shade
1:06.091 aoe m rune_of_power Fluffy_Pillow 33921.9/72371: 47% mana arcane_charge(4), soothing_shade
1:07.397 aoe p arcane_barrage Fluffy_Pillow 35812.3/72371: 49% mana arcane_charge(4), rune_of_power, soothing_shade
1:08.703 aoe o arcane_explosion Fluffy_Pillow 40597.5/72371: 56% mana rune_of_power, soothing_shade
1:10.010 aoe o arcane_explosion Fluffy_Pillow 37489.2/72371: 52% mana arcane_charge, rune_of_power, soothing_shade
1:11.316 aoe o arcane_explosion Fluffy_Pillow 34379.6/72371: 48% mana arcane_charge(2), rune_of_power, soothing_shade
1:12.623 aoe o arcane_explosion Fluffy_Pillow 31271.4/72371: 43% mana arcane_charge(3), rune_of_power, soothing_shade
1:13.930 aoe p arcane_barrage Fluffy_Pillow 24660.8/63371: 39% mana arcane_charge(4), rune_of_power
1:15.239 aoe n arcane_orb Fluffy_Pillow 28854.8/63371: 46% mana rune_of_power
1:16.546 aoe p arcane_barrage Fluffy_Pillow 30011.3/63371: 47% mana arcane_charge(4), rune_of_power
1:17.853 aoe o arcane_explosion Fluffy_Pillow 34202.7/63371: 54% mana rune_of_power
1:19.162 aoe o arcane_explosion Fluffy_Pillow 30861.7/63371: 49% mana arcane_charge, rune_of_power
1:20.468 aoe o arcane_explosion Fluffy_Pillow 27517.0/63371: 43% mana arcane_charge(2)
1:21.776 aoe o arcane_explosion Fluffy_Pillow 24174.8/63371: 38% mana arcane_charge(3)
1:23.081 aoe p arcane_barrage Fluffy_Pillow 20828.8/63371: 33% mana arcane_charge(4)
1:24.388 aoe o arcane_explosion Fluffy_Pillow 25020.2/63371: 39% mana
1:25.697 aoe o arcane_explosion Fluffy_Pillow 21679.2/63371: 34% mana arcane_charge
1:27.003 aoe o arcane_explosion Fluffy_Pillow 18334.5/63371: 29% mana arcane_charge(2), clearcasting
1:28.310 aoe o arcane_explosion Fluffy_Pillow 19991.0/63371: 32% mana arcane_charge(3)
1:29.615 aoe p arcane_barrage Fluffy_Pillow 19009.0/72371: 26% mana arcane_charge(4), clearcasting, soothing_shade
1:30.921 aoe o arcane_explosion Fluffy_Pillow 23794.2/72371: 33% mana clearcasting, soothing_shade
1:32.228 aoe o arcane_explosion Fluffy_Pillow 25685.9/72371: 35% mana arcane_charge, soothing_shade
1:33.534 aoe o arcane_explosion Fluffy_Pillow 22576.3/72371: 31% mana arcane_charge(2), soothing_shade
1:34.841 aoe o arcane_explosion Fluffy_Pillow 19468.1/72371: 27% mana arcane_charge(3), soothing_shade
1:36.148 aoe p arcane_barrage Fluffy_Pillow 16359.9/72371: 23% mana arcane_charge(4), soothing_shade
1:37.456 aoe n arcane_orb Fluffy_Pillow 21148.0/72371: 29% mana soothing_shade
1:38.761 aoe p arcane_barrage Fluffy_Pillow 22536.8/72371: 31% mana arcane_charge(4), soothing_shade
1:40.067 aoe o arcane_explosion Fluffy_Pillow 27322.0/72371: 38% mana soothing_shade
1:41.372 aoe o arcane_explosion Fluffy_Pillow 21200.1/63371: 33% mana arcane_charge
1:42.680 aoe o arcane_explosion Fluffy_Pillow 17857.9/63371: 28% mana arcane_charge(2), clearcasting
1:43.986 aoe o arcane_explosion Fluffy_Pillow 19513.2/63371: 31% mana arcane_charge(3)
1:45.293 aoe p arcane_barrage Fluffy_Pillow 16169.7/63371: 26% mana arcane_charge(4)
1:46.599 aoe o arcane_explosion Fluffy_Pillow 20359.8/63371: 32% mana
1:47.906 aoe o arcane_explosion Fluffy_Pillow 17016.3/63371: 27% mana arcane_charge, clearcasting
1:49.213 aoe o arcane_explosion Fluffy_Pillow 18672.9/63371: 29% mana arcane_charge(2)
1:50.520 aoe o arcane_explosion Fluffy_Pillow 15329.4/63371: 24% mana arcane_charge(3)
1:51.826 aoe p arcane_barrage Fluffy_Pillow 11984.7/63371: 19% mana arcane_charge(4)
1:53.133 aoe k touch_of_the_magi Fluffy_Pillow 16176.0/63371: 26% mana
1:54.441 aoe m rune_of_power Fluffy_Pillow 17511.6/72371: 24% mana arcane_charge(4), soothing_shade
1:55.746 aoe p arcane_barrage Fluffy_Pillow 19400.4/72371: 27% mana arcane_charge(4), rune_of_power, soothing_shade
1:57.053 aoe o arcane_explosion Fluffy_Pillow 24187.1/72371: 33% mana rune_of_power, soothing_shade
1:58.360 aoe o arcane_explosion Fluffy_Pillow 21078.9/72371: 29% mana arcane_charge, rune_of_power, soothing_shade
1:59.667 aoe o arcane_explosion Fluffy_Pillow 17970.7/72371: 25% mana arcane_charge(2), rune_of_power, soothing_shade
2:00.975 aoe o arcane_explosion Fluffy_Pillow 14863.9/72371: 21% mana arcane_charge(3), rune_of_power, soothing_shade
2:02.281 aoe p arcane_barrage Fluffy_Pillow 11754.3/72371: 16% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
2:03.587 aoe n arcane_orb Fluffy_Pillow 16539.5/72371: 23% mana clearcasting, rune_of_power, soothing_shade
2:04.891 aoe p arcane_barrage Fluffy_Pillow 17926.9/72371: 25% mana arcane_charge(4), clearcasting, rune_of_power, soothing_shade
2:06.196 aoe o arcane_explosion Fluffy_Pillow 22710.6/72371: 31% mana clearcasting, rune_of_power, soothing_shade
2:07.502 aoe o arcane_explosion Fluffy_Pillow 21541.6/63371: 34% mana arcane_charge, rune_of_power
2:08.810 aoe o arcane_explosion Fluffy_Pillow 18199.4/63371: 29% mana arcane_charge(2)
2:10.117 aoe o arcane_explosion Fluffy_Pillow 14856.0/63371: 23% mana arcane_charge(3)
2:11.424 aoe l arcane_power Fluffy_Pillow 11512.5/63371: 18% mana arcane_charge(4)
2:11.424 aoe p arcane_barrage Fluffy_Pillow 11512.5/63371: 18% mana arcane_charge(4), arcane_power, rune_of_power
2:12.730 aoe o arcane_explosion Fluffy_Pillow 15702.6/63371: 25% mana arcane_power, rune_of_power
2:14.036 aoe o arcane_explosion Fluffy_Pillow 14857.9/63371: 23% mana arcane_charge, arcane_power, rune_of_power
2:15.342 aoe o arcane_explosion Fluffy_Pillow 14013.1/63371: 22% mana arcane_charge(2), arcane_power, rune_of_power
2:16.648 aoe o arcane_explosion Fluffy_Pillow 13168.4/63371: 21% mana arcane_charge(3), arcane_power, rune_of_power
2:17.956 aoe p arcane_barrage Fluffy_Pillow 12326.2/63371: 19% mana arcane_charge(4), arcane_power, rune_of_power
2:19.263 aoe o arcane_explosion Fluffy_Pillow 16517.6/63371: 26% mana arcane_power, rune_of_power
2:20.572 aoe o arcane_explosion Fluffy_Pillow 17903.1/72371: 25% mana arcane_charge, arcane_power, rune_of_power, soothing_shade
2:21.880 aoe o arcane_explosion Fluffy_Pillow 17296.3/72371: 24% mana arcane_charge(2), arcane_power, rune_of_power, soothing_shade
2:23.187 aoe o arcane_explosion Fluffy_Pillow 16688.1/72371: 23% mana arcane_charge(3), arcane_power, rune_of_power, soothing_shade
2:24.493 aoe p arcane_barrage Fluffy_Pillow 16078.4/72371: 22% mana arcane_charge(4), arcane_power, soothing_shade
2:25.801 aoe n arcane_orb Fluffy_Pillow 20866.5/72371: 29% mana arcane_power, soothing_shade
2:27.108 aoe p arcane_barrage Fluffy_Pillow 22508.3/72371: 31% mana arcane_charge(4), soothing_shade
2:28.415 aoe o arcane_explosion Fluffy_Pillow 27294.9/72371: 38% mana soothing_shade
2:29.722 aoe o arcane_explosion Fluffy_Pillow 24186.7/72371: 33% mana arcane_charge, soothing_shade
2:31.027 shared_cds r use_mana_gem Venthyr_Theotar 21075.6/72371: 29% mana arcane_charge(2), soothing_shade
2:31.027 aoe o arcane_explosion Fluffy_Pillow 28312.8/72371: 39% mana arcane_charge(2), soothing_shade
2:32.334 aoe o arcane_explosion Fluffy_Pillow 22070.2/63371: 35% mana arcane_charge(3)
2:33.641 aoe p arcane_barrage Fluffy_Pillow 18726.7/63371: 30% mana arcane_charge(4)
2:34.948 aoe o arcane_explosion Fluffy_Pillow 22918.1/63371: 36% mana
2:36.252 aoe o arcane_explosion Fluffy_Pillow 19570.8/63371: 31% mana arcane_charge
2:37.558 aoe o arcane_explosion Fluffy_Pillow 16226.1/63371: 26% mana arcane_charge(2)
2:38.864 aoe o arcane_explosion Fluffy_Pillow 12881.3/63371: 20% mana arcane_charge(3)
2:40.169 aoe p arcane_barrage Fluffy_Pillow 9535.3/63371: 15% mana arcane_charge(4)
2:41.475 aoe j mirrors_of_torment Fluffy_Pillow 13725.4/63371: 22% mana
2:42.781 aoe k touch_of_the_magi Fluffy_Pillow 13380.7/63371: 21% mana clearcasting
2:44.086 aoe m rune_of_power Fluffy_Pillow 12534.7/63371: 20% mana arcane_charge(4), clearcasting
2:45.392 aoe p arcane_barrage Fluffy_Pillow 16724.8/63371: 26% mana arcane_charge(4), clearcasting, rune_of_power
2:46.698 aoe n arcane_orb Fluffy_Pillow 20914.9/63371: 33% mana clearcasting, rune_of_power
2:48.005 aoe p arcane_barrage Fluffy_Pillow 22071.5/63371: 35% mana arcane_charge(4), clearcasting, rune_of_power
2:49.312 aoe o arcane_explosion Fluffy_Pillow 26262.8/63371: 41% mana clearcasting, rune_of_power
2:50.620 aoe o arcane_explosion Fluffy_Pillow 30455.5/63371: 48% mana arcane_charge, rune_of_power
2:51.927 aoe o arcane_explosion Fluffy_Pillow 27112.0/63371: 43% mana arcane_charge(2), rune_of_power
2:53.234 aoe o arcane_explosion Fluffy_Pillow 23768.6/63371: 38% mana arcane_charge(3), rune_of_power
2:54.540 aoe p arcane_barrage Fluffy_Pillow 20423.8/63371: 32% mana arcane_charge(4), clearcasting, rune_of_power
2:55.846 aoe o arcane_explosion Fluffy_Pillow 24613.9/63371: 39% mana clearcasting, rune_of_power
2:57.153 aoe o arcane_explosion Fluffy_Pillow 28805.3/63371: 45% mana arcane_charge, rune_of_power
2:58.461 aoe o arcane_explosion Fluffy_Pillow 25463.1/63371: 40% mana arcane_charge(2)
2:59.768 aoe o arcane_explosion Fluffy_Pillow 22119.7/63371: 35% mana arcane_charge(3)
3:01.074 aoe p arcane_barrage Fluffy_Pillow 18774.9/63371: 30% mana arcane_charge(4), clearcasting
3:02.379 aoe o arcane_explosion Fluffy_Pillow 22963.8/63371: 36% mana clearcasting
3:03.685 aoe o arcane_explosion Fluffy_Pillow 24619.0/63371: 39% mana arcane_charge
3:04.990 aoe o arcane_explosion Fluffy_Pillow 21273.0/63371: 34% mana arcane_charge(2)
3:06.297 aoe o arcane_explosion Fluffy_Pillow 17929.6/63371: 28% mana arcane_charge(3)
3:07.604 aoe p arcane_barrage Fluffy_Pillow 14586.1/63371: 23% mana arcane_charge(4)
3:08.910 aoe n arcane_orb Fluffy_Pillow 18776.2/63371: 30% mana
3:10.217 aoe p arcane_barrage Fluffy_Pillow 19932.7/63371: 31% mana arcane_charge(4)
3:11.524 aoe o arcane_explosion Fluffy_Pillow 24124.1/63371: 38% mana
3:12.831 aoe o arcane_explosion Fluffy_Pillow 20780.6/63371: 33% mana arcane_charge, clearcasting
3:14.138 aoe o arcane_explosion Fluffy_Pillow 22437.2/63371: 35% mana arcane_charge(2)
3:15.445 aoe o arcane_explosion Fluffy_Pillow 19093.7/63371: 30% mana arcane_charge(3)
3:16.750 aoe p arcane_barrage Fluffy_Pillow 15747.7/63371: 25% mana arcane_charge(4)
3:18.054 aoe o arcane_explosion Fluffy_Pillow 19935.3/63371: 31% mana
3:19.360 aoe o arcane_explosion Fluffy_Pillow 16590.5/63371: 26% mana arcane_charge
3:20.666 aoe o arcane_explosion Fluffy_Pillow 13245.8/63371: 21% mana arcane_charge(2)
3:21.973 aoe o arcane_explosion Fluffy_Pillow 9902.3/63371: 16% mana arcane_charge(3)
3:23.281 aoe p arcane_barrage Fluffy_Pillow 6560.1/63371: 10% mana arcane_charge(4)
3:24.585 aoe o arcane_explosion Fluffy_Pillow 10747.7/63371: 17% mana
3:25.892 aoe o arcane_explosion Fluffy_Pillow 7404.2/63371: 12% mana arcane_charge
3:27.197 aoe q evocation Venthyr_Theotar 4058.2/63371: 6% mana arcane_charge(2)
3:31.541 aoe k touch_of_the_magi Fluffy_Pillow 57902.9/63371: 91% mana arcane_charge(2)
3:32.848 aoe m rune_of_power Fluffy_Pillow 57059.4/63371: 90% mana arcane_charge(4)
3:34.154 aoe p arcane_barrage Fluffy_Pillow 58714.7/63371: 93% mana arcane_charge(4), rune_of_power
3:35.462 aoe n arcane_orb Fluffy_Pillow 62907.3/63371: 99% mana rune_of_power
3:36.768 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power
3:38.074 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
3:39.382 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge, rune_of_power
3:40.688 aoe o arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), rune_of_power
3:41.995 aoe o arcane_explosion Fluffy_Pillow 53341.0/63371: 84% mana arcane_charge(3), clearcasting, rune_of_power
3:43.301 aoe p arcane_barrage Fluffy_Pillow 54996.3/63371: 87% mana arcane_charge(4), rune_of_power
3:44.609 aoe o arcane_explosion Fluffy_Pillow 59188.9/63371: 93% mana rune_of_power
3:45.913 aoe o arcane_explosion Fluffy_Pillow 63772.3/72371: 88% mana arcane_charge, rune_of_power, soothing_shade
3:47.220 aoe o arcane_explosion Fluffy_Pillow 60664.1/72371: 84% mana arcane_charge(2), clearcasting, soothing_shade
3:48.526 aoe o arcane_explosion Fluffy_Pillow 62554.4/72371: 86% mana arcane_charge(3), soothing_shade
3:49.832 aoe p arcane_barrage Fluffy_Pillow 59444.8/72371: 82% mana arcane_charge(4), clearcasting, soothing_shade
3:51.138 aoe o arcane_explosion Fluffy_Pillow 64230.0/72371: 89% mana clearcasting, soothing_shade
3:52.443 aoe o arcane_explosion Fluffy_Pillow 66118.8/72371: 91% mana arcane_charge, soothing_shade
3:53.747 aoe o arcane_explosion Fluffy_Pillow 63006.3/72371: 87% mana arcane_charge(2), clearcasting, soothing_shade
3:55.054 aoe o arcane_explosion Fluffy_Pillow 64898.1/72371: 90% mana arcane_charge(3), soothing_shade
3:56.360 aoe p arcane_barrage Fluffy_Pillow 61788.4/72371: 85% mana arcane_charge(4), soothing_shade
3:57.667 aoe n arcane_orb Fluffy_Pillow 58295.9/63371: 92% mana
3:58.975 aoe p arcane_barrage Fluffy_Pillow 59453.7/63371: 94% mana arcane_charge(4)
4:00.281 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
4:01.588 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
4:02.895 aoe o arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2), clearcasting
4:04.203 aoe o arcane_explosion Fluffy_Pillow 58342.3/63371: 92% mana arcane_charge(3)
4:05.511 aoe p arcane_barrage Fluffy_Pillow 55000.1/63371: 87% mana arcane_charge(4), clearcasting
4:06.818 aoe o arcane_explosion Fluffy_Pillow 59191.5/63371: 93% mana clearcasting
4:08.124 aoe o arcane_explosion Fluffy_Pillow 60846.7/63371: 96% mana arcane_charge
4:09.431 aoe o arcane_explosion Fluffy_Pillow 57503.3/63371: 91% mana arcane_charge(2)
4:10.737 aoe o arcane_explosion Fluffy_Pillow 54158.5/63371: 85% mana arcane_charge(3)
4:12.043 aoe p arcane_barrage Fluffy_Pillow 50813.8/63371: 80% mana arcane_charge(4)
4:13.351 aoe o arcane_explosion Fluffy_Pillow 55006.4/63371: 87% mana
4:14.657 aoe o arcane_explosion Fluffy_Pillow 51661.7/63371: 82% mana arcane_charge
4:15.964 aoe o arcane_explosion Fluffy_Pillow 48318.2/63371: 76% mana arcane_charge(2), clearcasting
4:17.272 aoe o arcane_explosion Fluffy_Pillow 49976.0/63371: 79% mana arcane_charge(3)
4:18.579 aoe p arcane_barrage Fluffy_Pillow 46632.6/63371: 74% mana arcane_charge(4)
4:19.886 aoe j mirrors_of_torment Fluffy_Pillow 50823.9/63371: 80% mana
4:21.194 aoe k touch_of_the_magi Fluffy_Pillow 50481.7/63371: 80% mana
4:22.499 aoe l arcane_power Fluffy_Pillow 49635.7/63371: 78% mana arcane_charge(4)
4:22.499 shared_cds t berserking Fluffy_Pillow 49635.7/63371: 78% mana arcane_charge(4), arcane_power, rune_of_power
4:22.499 aoe p arcane_barrage Fluffy_Pillow 49635.7/63371: 78% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:23.687 aoe n arcane_orb Fluffy_Pillow 56211.1/63371: 89% mana berserking, arcane_power, rune_of_power
4:24.872 aoe p arcane_barrage Fluffy_Pillow 57463.1/63371: 91% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:26.061 aoe o arcane_explosion Fluffy_Pillow 61504.9/63371: 97% mana berserking, arcane_power, clearcasting, rune_of_power
4:27.249 aoe o arcane_explosion Fluffy_Pillow 63010.6/63371: 99% mana berserking, arcane_charge, arcane_power, rune_of_power
4:28.437 aoe o arcane_explosion Fluffy_Pillow 62016.3/63371: 98% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:29.625 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:30.816 aoe p arcane_barrage Fluffy_Pillow 71240.3/72371: 98% mana berserking, arcane_charge(4), arcane_power, rune_of_power, soothing_shade
4:32.005 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana berserking, arcane_power, rune_of_power, soothing_shade
4:33.194 aoe o arcane_explosion Fluffy_Pillow 71592.4/72371: 99% mana berserking, arcane_charge, arcane_power, rune_of_power, soothing_shade
4:34.383 aoe o arcane_explosion Fluffy_Pillow 70813.4/72371: 98% mana berserking, arcane_charge(2), arcane_power, rune_of_power, soothing_shade
4:35.571 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana arcane_charge(3), arcane_power, soothing_shade
4:36.879 aoe m rune_of_power Fluffy_Pillow 71764.7/72371: 99% mana arcane_charge(4), arcane_power, soothing_shade
4:38.186 aoe p arcane_barrage Fluffy_Pillow 72371.4/72371: 100% mana arcane_charge(4), rune_of_power, soothing_shade
4:39.491 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana rune_of_power, soothing_shade
4:40.798 aoe o arcane_explosion Fluffy_Pillow 69263.2/72371: 96% mana arcane_charge, rune_of_power, soothing_shade
4:42.105 aoe o arcane_explosion Fluffy_Pillow 57928.1/63371: 91% mana arcane_charge(2), rune_of_power
4:43.412 aoe o arcane_explosion Fluffy_Pillow 54584.6/63371: 86% mana arcane_charge(3), rune_of_power
4:44.720 shared_cds r use_mana_gem Venthyr_Theotar 51242.4/63371: 81% mana arcane_charge(4), rune_of_power
4:44.720 aoe p arcane_barrage Fluffy_Pillow 57579.5/63371: 91% mana arcane_charge(4), rune_of_power
4:46.026 aoe n arcane_orb Fluffy_Pillow 61769.7/63371: 97% mana rune_of_power
4:47.334 aoe p arcane_barrage Fluffy_Pillow 62927.5/63371: 99% mana arcane_charge(4), rune_of_power
4:48.640 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
4:49.946 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power
4:51.249 aoe o arcane_explosion Fluffy_Pillow 56678.1/63371: 89% mana arcane_charge(2)
4:52.557 aoe o arcane_explosion Fluffy_Pillow 53335.9/63371: 84% mana arcane_charge(3)
4:53.862 aoe p arcane_barrage Fluffy_Pillow 49989.9/63371: 79% mana arcane_charge(4)
4:55.169 aoe o arcane_explosion Fluffy_Pillow 54181.3/63371: 85% mana
4:56.476 aoe o arcane_explosion Fluffy_Pillow 50837.9/63371: 80% mana arcane_charge
4:57.783 aoe o arcane_explosion Fluffy_Pillow 47494.4/63371: 75% mana arcane_charge(2)
4:59.089 aoe o arcane_explosion Fluffy_Pillow 44149.6/63371: 70% mana arcane_charge(3)
5:00.395 aoe p arcane_barrage Fluffy_Pillow 40804.9/63371: 64% mana arcane_charge(4)
5:01.703 aoe o arcane_explosion Fluffy_Pillow 44997.6/63371: 71% mana
5:03.009 aoe o arcane_explosion Fluffy_Pillow 41652.8/63371: 66% mana arcane_charge, clearcasting
5:04.316 aoe o arcane_explosion Fluffy_Pillow 43309.4/63371: 68% mana arcane_charge(2)
5:05.622 aoe o arcane_explosion Fluffy_Pillow 39964.6/63371: 63% mana arcane_charge(3)
5:06.930 aoe p arcane_barrage Fluffy_Pillow 36622.4/63371: 58% mana arcane_charge(4)
5:08.236 aoe n arcane_orb Fluffy_Pillow 40812.5/63371: 64% mana
5:09.543 aoe p arcane_barrage Fluffy_Pillow 41969.1/63371: 66% mana arcane_charge(4)
5:10.850 aoe o arcane_explosion Fluffy_Pillow 46160.4/63371: 73% mana
5:12.157 aoe o arcane_explosion Fluffy_Pillow 42817.0/63371: 68% mana arcane_charge
5:13.462 aoe o arcane_explosion Fluffy_Pillow 39471.0/63371: 62% mana arcane_charge(2)
5:14.770 aoe o arcane_explosion Fluffy_Pillow 36128.8/63371: 57% mana arcane_charge(3)
5:16.076 aoe p arcane_barrage Fluffy_Pillow 32784.0/63371: 52% mana arcane_charge(4)
5:17.381 aoe o arcane_explosion Fluffy_Pillow 36972.9/63371: 58% mana
5:18.689 aoe o arcane_explosion Fluffy_Pillow 33630.7/63371: 53% mana arcane_charge
5:19.995 aoe o arcane_explosion Fluffy_Pillow 30285.9/63371: 48% mana arcane_charge(2), clearcasting
5:21.301 aoe o arcane_explosion Fluffy_Pillow 31941.2/63371: 50% mana arcane_charge(3)
5:22.608 aoe p arcane_barrage Fluffy_Pillow 28597.7/63371: 45% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 15844 dps, 4331 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
15844.5 15844.5 23.1 / 0.146% 1500.2 / 9.5% 7.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
2049.2 1947.9 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 15844
Arcane Barrage 5657 35.7% 56.8 5.25sec 29642 23862 Direct 283.4 4973 9977 5939 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.77 283.41 0.00 0.00 1.2422 0.0000 1682809.50 1682809.50 0.00% 23862.19 23862.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 228.72 172 291 4972.81 2082 25140 4968.74 4352 5466 1137275 1137275 0.00%
crit 19.30% 54.69 30 80 9976.96 4164 50280 9967.43 7680 13490 545534 545534 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:56.78
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 392 2.5% 36.8 7.69sec 3166 0 Direct 184.0 531 1062 633 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.80 184.00 0.00 0.00 0.0000 0.0000 116509.87 116509.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 148.53 101 191 530.95 443 664 530.32 497 555 78839 78839 0.00%
crit 19.28% 35.48 15 61 1062.08 886 1329 1060.92 919 1202 37671 37671 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7650 48.3% 153.4 1.91sec 14825 11935 Direct 767.0 2487 4975 2965 19.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.40 767.02 0.00 0.00 1.2421 0.0000 2274144.22 2274144.22 0.00% 11934.70 11934.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 619.64 490 785 2487.20 1958 4112 2486.82 2383 2583 1540932 1540932 0.00%
crit 19.21% 147.38 98 204 4975.28 3916 8223 4975.05 4575 5437 733212 733212 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:153.44
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1370) 0.0% (8.6%) 13.0 23.65sec 31316 25122

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.00 0.00 0.00 0.00 1.2466 0.0000 0.00 0.00 0.00% 25122.06 25122.06

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.00
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1370 8.6% 64.9 23.65sec 6274 0 Direct 64.9 5268 10485 6274 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.88 64.88 0.00 0.00 0.0000 0.0000 407002.54 407002.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 52.36 36 70 5267.85 3869 8126 5269.01 4643 5820 275794 275794 0.00%
crit 19.29% 12.52 2 28 10484.90 7739 16251 10485.06 8083 13930 131209 131209 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.5 1.77sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.5 1.77sec 1390 0 Direct 14.5 1164 2327 1390 19.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.52 14.52 0.00 0.00 0.0000 0.0000 20179.64 20179.64 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.56% 11.70 5 18 1163.53 1164 1164 1163.53 1164 1164 13612 13612 0.00%
crit 19.44% 2.82 0 9 2327.06 2327 2327 2221.19 0 2327 6568 6568 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1750 18.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1751.45 1751.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.71% 0.82 0 1 1480.68 1481 1481 1209.90 0 1481 1210 1210 0.00%
crit 18.29% 0.18 0 1 2961.35 2961 2961 541.55 0 2961 542 542 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5790 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5790.02 5790.02 0.00% 49.16 49.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 72.62 61 83 53.95 43 60 53.95 52 55 3917 3917 0.00%
crit 19.32% 17.38 7 29 107.71 86 120 107.70 96 119 1873 1873 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (681) 0.0% (4.3%) 6.1 52.15sec 32941 25213

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 25213.44 25213.44

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 681 4.3% 6.1 52.00sec 32941 0 Direct 30.6 6618 0 6618 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 30.58 0.00 0.00 0.0000 0.0000 202287.40 202287.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.58 25 35 6618.18 1576 37197 6610.84 4612 9143 202287 202287 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20041.85
  • base_dd_max:20041.85
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.8 128.44sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 256.74sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [s]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 156.60sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.19 0.00 7.07 0.00 4.3030 0.7219 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.19
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [r]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.18sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.99 0.00 0.00 0.00 1.2564 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.01
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 124.51sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.5 179.9 5.2sec 1.2sec 3.8sec 73.98% 0.00% 26.7 (26.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.03%
  • arcane_charge_2:16.48%
  • arcane_charge_3:16.87%
  • arcane_charge_4:21.60%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.4sec 128.4sec 14.6sec 13.96% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 136.7s
  • trigger_min/max:120.8s / 136.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.96%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 256.7sec 256.7sec 11.6sec 7.13% 23.62% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.6s
  • trigger_min/max:253.9s / 265.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.13%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.63% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.63%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.2 0.1 11.9sec 11.8sec 1.9sec 15.84% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.73%
  • clearcasting_2:0.12%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 163.7sec 163.7sec 4.3sec 1.72% 0.00% 4.7 (4.7) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:91.9s / 260.4s
  • trigger_min/max:91.9s / 260.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.72%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism) 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:20.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • feast_of_gluttonous_hedonism_1:100.00%

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.52%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.0sec 35.0sec 11.8sec 34.95% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 52.7s
  • trigger_min/max:13.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.95%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power 1.0 0.0 0.0sec 0.0sec 297.4sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:70.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • spectral_flask_of_power_1:100.00%

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.09% 0.77% 5.98% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 297.4s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000177.405120.026239.962
Evocation138.5911.889333.959207.810114.198342.838
Rune of Power6.1750.00620.78638.26223.99553.319
Touch of the Magi4.8640.00020.78131.15022.38850.967
Arcane Power5.9060.75716.72617.0217.93226.884
Arcane Barrage2.7460.0028.280156.979126.740192.413
Arcane Orb3.5280.01310.48946.17233.73565.434

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 488.34 366805.91 63.32% 751.13 9528.14 2.53%
Evocation Mana 56.58 56874.90 9.82% 1005.28 0.00 0.00%
Mana Gem Mana 2.73 17322.64 2.99% 6337.14 0.00 0.00%
Arcane Barrage Mana 56.78 138255.38 23.87% 2435.11 5662.98 3.93%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1947.90 2049.24 15181.0 33231.7 31.9 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 153.4 587315.3 3827.7 3828.6 3.9
arcane_orb Mana 13.0 5812.9 447.3 447.3 70.0
touch_of_the_magi Mana 6.1 15347.4 2500.0 2499.2 13.2

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
arcane Damage Per Second
Count 1121
Mean 15844.49
Minimum 14715.01
Maximum 17070.00
Spread ( max - min ) 2354.99
Range [ ( max - min ) / 2 * 100% ] 7.43%
Standard Deviation 395.1506
5th Percentile 15227.22
95th Percentile 16505.35
( 95th Percentile - 5th Percentile ) 1278.13
Mean Distribution
Standard Deviation 11.8021
95.00% Confidence Interval ( 15821.36 - 15867.62 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2390
0.1 Scale Factor Error with Delta=300 1333
0.05 Scale Factor Error with Delta=300 5332
0.01 Scale Factor Error with Delta=300 133294
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1121
Mean 4331.12
Minimum 3904.72
Maximum 4920.50
Spread ( max - min ) 1015.78
Range [ ( max - min ) / 2 * 100% ] 11.73%
Standard Deviation 164.7133
5th Percentile 4071.30
95th Percentile 4614.95
( 95th Percentile - 5th Percentile ) 543.64
Mean Distribution
Standard Deviation 4.9196
95.00% Confidence Interval ( 4321.48 - 4340.76 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5556
0.1 Scale Factor Error with Delta=300 232
0.05 Scale Factor Error with Delta=300 927
0.01 Scale Factor Error with Delta=300 23161
DPS(e)
arcane Damage Per Second (Effective)
Count 1121
Mean 15844.49
Minimum 14715.01
Maximum 17070.00
Spread ( max - min ) 2354.99
Range [ ( max - min ) / 2 * 100% ] 7.43%
Damage
arcane Damage
Count 1121
Mean 4704684.63
Minimum 3652434.57
Maximum 5650449.42
Spread ( max - min ) 1998014.85
Range [ ( max - min ) / 2 * 100% ] 21.23%
DTPS
arcane Damage Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.01 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.00 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 153.44 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 56.78 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.19 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
r 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
s 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkrsomonnnnonnnnonnnnlonnnnomonnnqnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnkonnnnonnnnomonnqnnonnnnojlonnnnomonnnnonnnpnomonnnnonnnnonjlomonnnnonnnnonnnnomonnnnonnnnonnnnojksomonnnnonnnqnlonnnnomonnnnonnnnonnnnomonnnnonnnnojlon

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), clearcasting
0:01.306 shared_cds r potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power
0:01.306 shared_cds s berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe o arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:03.133 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.045 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.958 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.872 aoe n arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.787 aoe n arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.702 aoe o arcane_barrage Fluffy_Pillow 59349.3/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.617 aoe n arcane_explosion Fluffy_Pillow 63043.8/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.532 aoe n arcane_explosion Fluffy_Pillow 61703.5/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:10.446 aoe n arcane_explosion Fluffy_Pillow 62861.9/63371: 99% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.360 aoe n arcane_explosion Fluffy_Pillow 61520.4/63371: 97% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.275 aoe o arcane_barrage Fluffy_Pillow 60180.1/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.187 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.104 aoe n arcane_explosion Fluffy_Pillow 62033.7/63371: 98% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.111 aoe n arcane_explosion Fluffy_Pillow 60810.0/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.117 aoe n arcane_explosion Fluffy_Pillow 59585.0/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.123 aoe l rune_of_power Fluffy_Pillow 58360.0/63371: 92% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.130 aoe o arcane_barrage Fluffy_Pillow 59636.3/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.137 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.144 aoe n arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, potion_of_deathly_fixation
0:21.150 aoe n arcane_explosion Fluffy_Pillow 60922.8/63371: 96% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.156 aoe n arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.162 aoe o arcane_barrage Fluffy_Pillow 58472.8/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.170 aoe m arcane_orb Fluffy_Pillow 62285.3/63371: 98% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.178 aoe o arcane_barrage Fluffy_Pillow 63062.8/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.185 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.191 aoe n arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.196 aoe n arcane_explosion Fluffy_Pillow 55920.2/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.202 shared_cds q use_mana_gem arcane 52195.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:29.202 aoe n arcane_explosion Fluffy_Pillow 58532.4/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power
0:30.208 aoe o arcane_barrage Fluffy_Pillow 54807.4/63371: 86% mana bloodlust, arcane_charge(4)
0:31.214 aoe n arcane_explosion Fluffy_Pillow 58617.3/63371: 92% mana bloodlust
0:32.222 aoe n arcane_explosion Fluffy_Pillow 54894.9/63371: 87% mana bloodlust, arcane_charge, clearcasting
0:33.228 aoe n arcane_explosion Fluffy_Pillow 56169.9/63371: 89% mana bloodlust, arcane_charge(2)
0:34.234 aoe n arcane_explosion Fluffy_Pillow 52445.0/63371: 83% mana bloodlust, arcane_charge(3), clearcasting
0:35.240 aoe o arcane_barrage Fluffy_Pillow 53720.0/63371: 85% mana bloodlust, arcane_charge(4)
0:36.247 aoe n arcane_explosion Fluffy_Pillow 57531.2/63371: 91% mana bloodlust
0:37.255 aoe n arcane_explosion Fluffy_Pillow 53808.7/63371: 85% mana bloodlust, arcane_charge
0:38.261 aoe n arcane_explosion Fluffy_Pillow 50083.8/63371: 79% mana bloodlust, arcane_charge(2)
0:39.267 aoe n arcane_explosion Fluffy_Pillow 46358.8/63371: 73% mana bloodlust, arcane_charge(3)
0:40.274 aoe o arcane_barrage Fluffy_Pillow 42635.1/63371: 67% mana bloodlust, arcane_charge(4)
0:41.281 aoe n arcane_explosion Fluffy_Pillow 46446.2/63371: 73% mana
0:42.587 aoe n arcane_explosion Fluffy_Pillow 43101.5/63371: 68% mana arcane_charge
0:43.894 aoe n arcane_explosion Fluffy_Pillow 39758.0/63371: 63% mana arcane_charge(2)
0:45.200 aoe n arcane_explosion Fluffy_Pillow 36413.3/63371: 57% mana arcane_charge(3)
0:46.507 aoe o arcane_barrage Fluffy_Pillow 33069.8/63371: 52% mana arcane_charge(4)
0:47.815 aoe m arcane_orb Fluffy_Pillow 37262.5/63371: 59% mana
0:49.121 aoe o arcane_barrage Fluffy_Pillow 38417.7/63371: 61% mana arcane_charge(4)
0:50.426 aoe n arcane_explosion Fluffy_Pillow 42606.6/63371: 67% mana
0:51.732 aoe n arcane_explosion Fluffy_Pillow 39261.9/63371: 62% mana arcane_charge
0:53.040 aoe n arcane_explosion Fluffy_Pillow 35919.7/63371: 57% mana arcane_charge(2), clearcasting
0:54.346 aoe n arcane_explosion Fluffy_Pillow 37574.9/63371: 59% mana arcane_charge(3)
0:55.654 aoe o arcane_barrage Fluffy_Pillow 34232.7/63371: 54% mana arcane_charge(4)
0:56.960 aoe n arcane_explosion Fluffy_Pillow 38422.8/63371: 61% mana
0:58.267 aoe n arcane_explosion Fluffy_Pillow 35079.4/63371: 55% mana arcane_charge, clearcasting
0:59.574 aoe n arcane_explosion Fluffy_Pillow 36735.9/63371: 58% mana arcane_charge(2)
1:00.878 aoe n arcane_explosion Fluffy_Pillow 33388.6/63371: 53% mana arcane_charge(3)
1:02.186 aoe o arcane_barrage Fluffy_Pillow 30046.4/63371: 47% mana arcane_charge(4)
1:03.491 aoe j touch_of_the_magi Fluffy_Pillow 34235.3/63371: 54% mana
1:04.796 aoe l rune_of_power Fluffy_Pillow 33389.3/63371: 53% mana arcane_charge(4)
1:06.104 aoe o arcane_barrage Fluffy_Pillow 35047.1/63371: 55% mana arcane_charge(4), rune_of_power
1:07.410 aoe n arcane_explosion Fluffy_Pillow 39237.2/63371: 62% mana rune_of_power
1:08.717 aoe n arcane_explosion Fluffy_Pillow 35893.7/63371: 57% mana arcane_charge, rune_of_power
1:10.023 aoe n arcane_explosion Fluffy_Pillow 32549.0/63371: 51% mana arcane_charge(2), rune_of_power
1:11.331 aoe n arcane_explosion Fluffy_Pillow 29206.8/63371: 46% mana arcane_charge(3), rune_of_power
1:12.640 aoe o arcane_barrage Fluffy_Pillow 25865.8/63371: 41% mana arcane_charge(4), rune_of_power
1:13.946 aoe m arcane_orb Fluffy_Pillow 30055.9/63371: 47% mana rune_of_power
1:15.251 aoe o arcane_barrage Fluffy_Pillow 31209.9/63371: 49% mana arcane_charge(4), rune_of_power
1:16.557 aoe n arcane_explosion Fluffy_Pillow 35400.1/63371: 56% mana rune_of_power
1:17.865 aoe n arcane_explosion Fluffy_Pillow 32057.9/63371: 51% mana arcane_charge, rune_of_power
1:19.173 aoe n arcane_explosion Fluffy_Pillow 28715.6/63371: 45% mana arcane_charge(2), clearcasting
1:20.479 aoe n arcane_explosion Fluffy_Pillow 30370.9/63371: 48% mana arcane_charge(3)
1:21.785 aoe o arcane_barrage Fluffy_Pillow 27026.2/63371: 43% mana arcane_charge(4)
1:23.091 aoe n arcane_explosion Fluffy_Pillow 31216.3/63371: 49% mana
1:24.398 aoe n arcane_explosion Fluffy_Pillow 27872.8/63371: 44% mana arcane_charge
1:25.704 aoe n arcane_explosion Fluffy_Pillow 24528.1/63371: 39% mana arcane_charge(2), clearcasting
1:27.013 aoe n arcane_explosion Fluffy_Pillow 26187.1/63371: 41% mana arcane_charge(3)
1:28.318 aoe o arcane_barrage Fluffy_Pillow 22841.1/63371: 36% mana arcane_charge(4)
1:29.624 aoe n arcane_explosion Fluffy_Pillow 27031.3/63371: 43% mana
1:30.931 aoe n arcane_explosion Fluffy_Pillow 23687.8/63371: 37% mana arcane_charge
1:32.238 aoe n arcane_explosion Fluffy_Pillow 20344.3/63371: 32% mana arcane_charge(2)
1:33.546 aoe n arcane_explosion Fluffy_Pillow 17002.1/63371: 27% mana arcane_charge(3)
1:34.853 aoe o arcane_barrage Fluffy_Pillow 13658.6/63371: 22% mana arcane_charge(4)
1:36.159 aoe m arcane_orb Fluffy_Pillow 17848.8/63371: 28% mana
1:37.465 aoe o arcane_barrage Fluffy_Pillow 19004.0/63371: 30% mana arcane_charge(4)
1:38.772 aoe n arcane_explosion Fluffy_Pillow 23195.4/63371: 37% mana
1:40.079 aoe n arcane_explosion Fluffy_Pillow 19851.9/63371: 31% mana arcane_charge
1:41.386 aoe n arcane_explosion Fluffy_Pillow 16508.5/63371: 26% mana arcane_charge(2)
1:42.693 aoe n arcane_explosion Fluffy_Pillow 13165.0/63371: 21% mana arcane_charge(3)
1:44.000 aoe o arcane_barrage Fluffy_Pillow 9821.5/63371: 15% mana arcane_charge(4)
1:45.308 aoe n arcane_explosion Fluffy_Pillow 14014.2/63371: 22% mana
1:46.617 aoe n arcane_explosion Fluffy_Pillow 10673.2/63371: 17% mana arcane_charge, clearcasting
1:47.923 aoe n arcane_explosion Fluffy_Pillow 12328.5/63371: 19% mana arcane_charge(2)
1:49.229 aoe n arcane_explosion Fluffy_Pillow 8983.8/63371: 14% mana arcane_charge(3)
1:50.535 aoe o arcane_barrage Fluffy_Pillow 5639.0/63371: 9% mana arcane_charge(4)
1:51.842 aoe j touch_of_the_magi Fluffy_Pillow 9830.4/63371: 16% mana
1:53.149 aoe l rune_of_power Fluffy_Pillow 8986.9/63371: 14% mana arcane_charge(4)
1:54.457 aoe o arcane_barrage Fluffy_Pillow 10644.7/63371: 17% mana arcane_charge(4), rune_of_power
1:55.764 aoe n arcane_explosion Fluffy_Pillow 14836.1/63371: 23% mana rune_of_power
1:57.072 aoe n arcane_explosion Fluffy_Pillow 11493.9/63371: 18% mana arcane_charge, clearcasting, rune_of_power
1:58.378 aoe n arcane_explosion Fluffy_Pillow 13149.2/63371: 21% mana arcane_charge(2), rune_of_power
1:59.685 aoe n arcane_explosion Fluffy_Pillow 9805.7/63371: 15% mana arcane_charge(3), rune_of_power
2:00.992 aoe o arcane_barrage Fluffy_Pillow 6462.2/63371: 10% mana arcane_charge(4), rune_of_power
2:02.298 aoe m arcane_orb Fluffy_Pillow 10652.4/63371: 17% mana rune_of_power
2:03.606 aoe o arcane_barrage Fluffy_Pillow 11810.2/63371: 19% mana arcane_charge(4), rune_of_power
2:04.912 aoe n arcane_explosion Fluffy_Pillow 16000.3/63371: 25% mana rune_of_power
2:06.219 aoe n arcane_explosion Fluffy_Pillow 12656.8/63371: 20% mana arcane_charge, clearcasting, rune_of_power
2:07.525 aoe n arcane_explosion Fluffy_Pillow 14312.1/63371: 23% mana arcane_charge(2)
2:08.830 aoe n arcane_explosion Fluffy_Pillow 10966.1/63371: 17% mana arcane_charge(3)
2:10.136 aoe k arcane_power Fluffy_Pillow 7621.3/63371: 12% mana arcane_charge(4)
2:10.136 aoe o arcane_barrage Fluffy_Pillow 7621.3/63371: 12% mana arcane_charge(4), arcane_power, rune_of_power
2:11.442 aoe n arcane_explosion Fluffy_Pillow 11811.4/63371: 19% mana arcane_power, rune_of_power
2:12.748 aoe n arcane_explosion Fluffy_Pillow 10966.7/63371: 17% mana arcane_charge, arcane_power, rune_of_power
2:14.054 aoe n arcane_explosion Fluffy_Pillow 10122.0/63371: 16% mana arcane_charge(2), arcane_power, rune_of_power
2:15.360 aoe n arcane_explosion Fluffy_Pillow 9277.2/63371: 15% mana arcane_charge(3), arcane_power, rune_of_power
2:16.666 aoe o arcane_barrage Fluffy_Pillow 8432.5/63371: 13% mana arcane_charge(4), arcane_power, rune_of_power
2:17.972 aoe n arcane_explosion Fluffy_Pillow 12622.6/63371: 20% mana arcane_power, rune_of_power
2:19.279 aoe n arcane_explosion Fluffy_Pillow 11779.1/63371: 19% mana arcane_charge, arcane_power, rune_of_power
2:20.586 aoe n arcane_explosion Fluffy_Pillow 10935.7/63371: 17% mana arcane_charge(2), arcane_power, rune_of_power
2:21.893 aoe n arcane_explosion Fluffy_Pillow 10092.2/63371: 16% mana arcane_charge(3), arcane_power, rune_of_power
2:23.199 aoe o arcane_barrage Fluffy_Pillow 9247.5/63371: 15% mana arcane_charge(4), arcane_power
2:24.506 aoe m arcane_orb Fluffy_Pillow 13438.8/63371: 21% mana arcane_power
2:25.813 aoe o arcane_barrage Fluffy_Pillow 14845.4/63371: 23% mana arcane_charge(4)
2:27.121 aoe n arcane_explosion Fluffy_Pillow 19038.0/63371: 30% mana
2:28.427 aoe n arcane_explosion Fluffy_Pillow 15693.3/63371: 25% mana arcane_charge
2:29.733 shared_cds q use_mana_gem arcane 12348.6/63371: 19% mana arcane_charge(2), clearcasting
2:29.733 aoe n arcane_explosion Fluffy_Pillow 18685.7/63371: 29% mana arcane_charge(2), clearcasting
2:31.040 aoe n arcane_explosion Fluffy_Pillow 20342.2/63371: 32% mana arcane_charge(3)
2:32.348 aoe o arcane_barrage Fluffy_Pillow 17000.0/63371: 27% mana arcane_charge(4), clearcasting
2:33.655 aoe n arcane_explosion Fluffy_Pillow 21191.4/63371: 33% mana clearcasting
2:34.960 aoe n arcane_explosion Fluffy_Pillow 22845.4/63371: 36% mana arcane_charge
2:36.268 aoe n arcane_explosion Fluffy_Pillow 19503.2/63371: 31% mana arcane_charge(2)
2:37.573 aoe n arcane_explosion Fluffy_Pillow 16157.2/63371: 25% mana arcane_charge(3)
2:38.880 aoe o arcane_barrage Fluffy_Pillow 12813.7/63371: 20% mana arcane_charge(4)
2:40.187 aoe j touch_of_the_magi Fluffy_Pillow 17005.1/63371: 27% mana
2:41.494 aoe l rune_of_power Fluffy_Pillow 16161.6/63371: 26% mana arcane_charge(4)
2:42.802 aoe o arcane_barrage Fluffy_Pillow 17819.4/63371: 28% mana arcane_charge(4), rune_of_power
2:44.109 aoe n arcane_explosion Fluffy_Pillow 22010.8/63371: 35% mana rune_of_power
2:45.415 aoe n arcane_explosion Fluffy_Pillow 18666.1/63371: 29% mana arcane_charge, clearcasting, rune_of_power
2:46.721 aoe n arcane_explosion Fluffy_Pillow 20321.3/63371: 32% mana arcane_charge(2), rune_of_power
2:48.027 aoe n arcane_explosion Fluffy_Pillow 16976.6/63371: 27% mana arcane_charge(3), rune_of_power
2:49.334 aoe o arcane_barrage Fluffy_Pillow 13633.1/63371: 22% mana arcane_charge(4), rune_of_power
2:50.642 aoe m arcane_orb Fluffy_Pillow 17825.8/63371: 28% mana rune_of_power
2:51.949 aoe o arcane_barrage Fluffy_Pillow 18982.3/63371: 30% mana arcane_charge(4), rune_of_power
2:53.256 aoe n arcane_explosion Fluffy_Pillow 23173.7/63371: 37% mana rune_of_power
2:54.560 aoe n arcane_explosion Fluffy_Pillow 19826.4/63371: 31% mana arcane_charge, rune_of_power
2:55.866 aoe n arcane_explosion Fluffy_Pillow 16481.7/63371: 26% mana arcane_charge(2)
2:57.171 aoe n arcane_explosion Fluffy_Pillow 13135.7/63371: 21% mana arcane_charge(3)
2:58.477 aoe o arcane_barrage Fluffy_Pillow 9790.9/63371: 15% mana arcane_charge(4)
2:59.782 aoe n arcane_explosion Fluffy_Pillow 13979.8/63371: 22% mana
3:01.087 aoe n arcane_explosion Fluffy_Pillow 10633.8/63371: 17% mana arcane_charge
3:02.394 aoe n arcane_explosion Fluffy_Pillow 7290.3/63371: 12% mana arcane_charge(2)
3:03.700 aoe p evocation arcane 3945.6/63371: 6% mana arcane_charge(3)
3:08.045 aoe n arcane_explosion Fluffy_Pillow 57791.5/63371: 91% mana arcane_charge(3)
3:09.351 aoe o arcane_barrage Fluffy_Pillow 54446.8/63371: 86% mana arcane_charge(4)
3:10.659 aoe m arcane_orb Fluffy_Pillow 58639.4/63371: 93% mana
3:11.966 aoe o arcane_barrage Fluffy_Pillow 59796.0/63371: 94% mana arcane_charge(4)
3:13.273 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana
3:14.580 aoe n arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge
3:15.888 aoe n arcane_explosion Fluffy_Pillow 56685.8/63371: 89% mana arcane_charge(2), clearcasting
3:17.194 aoe n arcane_explosion Fluffy_Pillow 58341.0/63371: 92% mana arcane_charge(3)
3:18.498 aoe o arcane_barrage Fluffy_Pillow 54993.7/63371: 87% mana arcane_charge(4)
3:19.803 aoe n arcane_explosion Fluffy_Pillow 59182.6/63371: 93% mana
3:21.109 aoe n arcane_explosion Fluffy_Pillow 55837.9/63371: 88% mana arcane_charge, clearcasting
3:22.415 aoe n arcane_explosion Fluffy_Pillow 57493.1/63371: 91% mana arcane_charge(2)
3:23.720 aoe n arcane_explosion Fluffy_Pillow 54147.1/63371: 85% mana arcane_charge(3)
3:25.027 aoe o arcane_barrage Fluffy_Pillow 50803.6/63371: 80% mana arcane_charge(4)
3:26.333 aoe n arcane_explosion Fluffy_Pillow 54993.8/63371: 87% mana
3:27.638 aoe j touch_of_the_magi Fluffy_Pillow 51647.8/63371: 82% mana arcane_charge
3:28.944 aoe l rune_of_power Fluffy_Pillow 50803.0/63371: 80% mana arcane_charge(4)
3:30.250 aoe o arcane_barrage Fluffy_Pillow 52458.3/63371: 83% mana arcane_charge(4), rune_of_power
3:31.558 aoe m arcane_orb Fluffy_Pillow 56650.9/63371: 89% mana rune_of_power
3:32.865 aoe o arcane_barrage Fluffy_Pillow 57807.5/63371: 91% mana arcane_charge(4), rune_of_power
3:34.170 aoe n arcane_explosion Fluffy_Pillow 61996.3/63371: 98% mana rune_of_power
3:35.476 aoe n arcane_explosion Fluffy_Pillow 58651.6/63371: 93% mana arcane_charge, rune_of_power
3:36.781 aoe n arcane_explosion Fluffy_Pillow 55305.6/63371: 87% mana arcane_charge(2), clearcasting, rune_of_power
3:38.087 aoe n arcane_explosion Fluffy_Pillow 56960.8/63371: 90% mana arcane_charge(3), rune_of_power
3:39.393 aoe o arcane_barrage Fluffy_Pillow 53616.1/63371: 85% mana arcane_charge(4), rune_of_power
3:40.700 aoe n arcane_explosion Fluffy_Pillow 57807.5/63371: 91% mana rune_of_power
3:42.007 aoe n arcane_explosion Fluffy_Pillow 54464.0/63371: 86% mana arcane_charge, rune_of_power
3:43.313 aoe n arcane_explosion Fluffy_Pillow 51119.3/63371: 81% mana arcane_charge(2)
3:44.618 aoe n arcane_explosion Fluffy_Pillow 47773.3/63371: 75% mana arcane_charge(3), clearcasting
3:45.927 aoe o arcane_barrage Fluffy_Pillow 49432.3/63371: 78% mana arcane_charge(4)
3:47.235 aoe n arcane_explosion Fluffy_Pillow 53625.0/63371: 85% mana
3:48.540 aoe n arcane_explosion Fluffy_Pillow 50279.0/63371: 79% mana arcane_charge
3:49.847 aoe n arcane_explosion Fluffy_Pillow 46935.5/63371: 74% mana arcane_charge(2)
3:51.153 aoe n arcane_explosion Fluffy_Pillow 43590.8/63371: 69% mana arcane_charge(3)
3:52.458 aoe o arcane_barrage Fluffy_Pillow 40244.8/63371: 64% mana arcane_charge(4)
3:53.762 aoe m arcane_orb Fluffy_Pillow 44432.3/63371: 70% mana
3:55.067 aoe o arcane_barrage Fluffy_Pillow 45586.3/63371: 72% mana arcane_charge(4)
3:56.374 aoe n arcane_explosion Fluffy_Pillow 49777.7/63371: 79% mana
3:57.679 aoe n arcane_explosion Fluffy_Pillow 46431.7/63371: 73% mana arcane_charge
3:58.986 aoe n arcane_explosion Fluffy_Pillow 43088.2/63371: 68% mana arcane_charge(2)
4:00.294 aoe n arcane_explosion Fluffy_Pillow 39746.0/63371: 63% mana arcane_charge(3), clearcasting
4:01.600 aoe o arcane_barrage Fluffy_Pillow 41401.3/63371: 65% mana arcane_charge(4)
4:02.906 aoe n arcane_explosion Fluffy_Pillow 45591.4/63371: 72% mana
4:04.211 aoe n arcane_explosion Fluffy_Pillow 42245.4/63371: 67% mana arcane_charge
4:05.517 aoe n arcane_explosion Fluffy_Pillow 38900.7/63371: 61% mana arcane_charge(2)
4:06.824 aoe n arcane_explosion Fluffy_Pillow 35557.2/63371: 56% mana arcane_charge(3), clearcasting
4:08.132 aoe o arcane_barrage Fluffy_Pillow 37215.0/63371: 59% mana arcane_charge(4)
4:09.441 aoe n arcane_explosion Fluffy_Pillow 41408.9/63371: 65% mana
4:10.748 aoe n arcane_explosion Fluffy_Pillow 38065.5/63371: 60% mana arcane_charge, clearcasting
4:12.054 aoe n arcane_explosion Fluffy_Pillow 39720.7/63371: 63% mana arcane_charge(2)
4:13.362 aoe n arcane_explosion Fluffy_Pillow 36378.5/63371: 57% mana arcane_charge(3)
4:14.671 aoe o arcane_barrage Fluffy_Pillow 33037.6/63371: 52% mana arcane_charge(4)
4:15.977 aoe j touch_of_the_magi Fluffy_Pillow 37227.7/63371: 59% mana
4:17.283 aoe k arcane_power Fluffy_Pillow 36383.0/63371: 57% mana arcane_charge(4)
4:17.283 shared_cds s berserking Fluffy_Pillow 36383.0/63371: 57% mana arcane_charge(4), arcane_power, rune_of_power
4:17.283 aoe o arcane_barrage Fluffy_Pillow 36383.0/63371: 57% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:18.471 aoe m arcane_orb Fluffy_Pillow 40423.5/63371: 64% mana berserking, arcane_power, rune_of_power
4:19.660 aoe o arcane_barrage Fluffy_Pillow 41680.5/63371: 66% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power
4:20.849 aoe n arcane_explosion Fluffy_Pillow 45722.3/63371: 72% mana berserking, arcane_power, clearcasting, rune_of_power
4:22.038 aoe n arcane_explosion Fluffy_Pillow 47229.3/63371: 75% mana berserking, arcane_charge, arcane_power, rune_of_power
4:23.228 aoe n arcane_explosion Fluffy_Pillow 46237.5/63371: 73% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:24.416 aoe n arcane_explosion Fluffy_Pillow 45243.2/63371: 71% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:25.606 aoe o arcane_barrage Fluffy_Pillow 44251.5/63371: 70% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:26.794 aoe n arcane_explosion Fluffy_Pillow 48292.0/63371: 76% mana berserking, arcane_power, rune_of_power
4:27.982 aoe n arcane_explosion Fluffy_Pillow 47297.7/63371: 75% mana berserking, arcane_charge, arcane_power, rune_of_power
4:29.170 aoe n arcane_explosion Fluffy_Pillow 46303.5/63371: 73% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:30.357 shared_cds q use_mana_gem arcane 45307.9/63371: 71% mana arcane_charge(3), arcane_power
4:30.357 aoe n arcane_explosion Fluffy_Pillow 51645.0/63371: 81% mana arcane_charge(3), arcane_power
4:31.664 aoe l rune_of_power Fluffy_Pillow 50801.6/63371: 80% mana arcane_charge(4), arcane_power, clearcasting
4:32.969 aoe o arcane_barrage Fluffy_Pillow 52455.6/63371: 83% mana arcane_charge(4), clearcasting, rune_of_power
4:34.277 aoe n arcane_explosion Fluffy_Pillow 56648.2/63371: 89% mana clearcasting, rune_of_power
4:35.583 aoe n arcane_explosion Fluffy_Pillow 58303.5/63371: 92% mana arcane_charge, rune_of_power
4:36.888 aoe n arcane_explosion Fluffy_Pillow 54957.5/63371: 87% mana arcane_charge(2), rune_of_power
4:38.195 aoe n arcane_explosion Fluffy_Pillow 51614.0/63371: 81% mana arcane_charge(3), rune_of_power
4:39.501 aoe o arcane_barrage Fluffy_Pillow 48269.3/63371: 76% mana arcane_charge(4), rune_of_power
4:40.807 aoe m arcane_orb Fluffy_Pillow 52459.4/63371: 83% mana rune_of_power
4:42.113 aoe o arcane_barrage Fluffy_Pillow 53614.6/63371: 85% mana arcane_charge(4), rune_of_power
4:43.420 aoe n arcane_explosion Fluffy_Pillow 57806.0/63371: 91% mana rune_of_power
4:44.726 aoe n arcane_explosion Fluffy_Pillow 54461.3/63371: 86% mana arcane_charge, rune_of_power
4:46.033 aoe n arcane_explosion Fluffy_Pillow 51117.8/63371: 81% mana arcane_charge(2)
4:47.339 aoe n arcane_explosion Fluffy_Pillow 47773.1/63371: 75% mana arcane_charge(3)
4:48.646 aoe o arcane_barrage Fluffy_Pillow 44429.6/63371: 70% mana arcane_charge(4)
4:49.952 aoe n arcane_explosion Fluffy_Pillow 48619.7/63371: 77% mana
4:51.257 aoe n arcane_explosion Fluffy_Pillow 45273.7/63371: 71% mana arcane_charge
4:52.563 aoe n arcane_explosion Fluffy_Pillow 41929.0/63371: 66% mana arcane_charge(2)
4:53.868 aoe n arcane_explosion Fluffy_Pillow 38583.0/63371: 61% mana arcane_charge(3)
4:55.175 aoe o arcane_barrage Fluffy_Pillow 35239.5/63371: 56% mana arcane_charge(4), clearcasting
4:56.481 aoe n arcane_explosion Fluffy_Pillow 39429.6/63371: 62% mana clearcasting
4:57.787 aoe n arcane_explosion Fluffy_Pillow 41084.9/63371: 65% mana arcane_charge
4:59.092 aoe n arcane_explosion Fluffy_Pillow 37738.9/63371: 60% mana arcane_charge(2)
5:00.398 aoe n arcane_explosion Fluffy_Pillow 34394.1/63371: 54% mana arcane_charge(3)
5:01.704 aoe o arcane_barrage Fluffy_Pillow 31049.4/63371: 49% mana arcane_charge(4)
5:03.010 aoe m arcane_orb Fluffy_Pillow 35239.5/63371: 56% mana
5:04.317 aoe o arcane_barrage Fluffy_Pillow 36396.1/63371: 57% mana arcane_charge(4)
5:05.624 aoe n arcane_explosion Fluffy_Pillow 40587.4/63371: 64% mana
5:06.931 aoe n arcane_explosion Fluffy_Pillow 37244.0/63371: 59% mana arcane_charge
5:08.237 aoe n arcane_explosion Fluffy_Pillow 33899.2/63371: 53% mana arcane_charge(2)
5:09.544 aoe n arcane_explosion Fluffy_Pillow 30555.8/63371: 48% mana arcane_charge(3)
5:10.850 aoe o arcane_barrage Fluffy_Pillow 27211.0/63371: 43% mana arcane_charge(4)
5:12.158 aoe n arcane_explosion Fluffy_Pillow 31403.7/63371: 50% mana
5:13.466 aoe n arcane_explosion Fluffy_Pillow 28061.5/63371: 44% mana arcane_charge
5:14.773 aoe n arcane_explosion Fluffy_Pillow 24718.0/63371: 39% mana arcane_charge(2)
5:16.078 aoe n arcane_explosion Fluffy_Pillow 21372.0/63371: 34% mana arcane_charge(3)
5:17.384 aoe o arcane_barrage Fluffy_Pillow 18027.3/63371: 28% mana arcane_charge(4)
5:18.688 aoe j touch_of_the_magi Fluffy_Pillow 22214.8/63371: 35% mana
5:19.996 aoe l rune_of_power Fluffy_Pillow 21372.6/63371: 34% mana arcane_charge(4)
5:21.303 aoe o arcane_barrage Fluffy_Pillow 23029.2/63371: 36% mana arcane_charge(4), rune_of_power
5:22.609 aoe n arcane_explosion Fluffy_Pillow 27219.3/63371: 43% mana rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 1137
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 297.4 )

Performance:

Total Events Processed: 15285200
Max Event Queue: 216
Sim Seconds: 338150
CPU Seconds: 31.6563
Physical Seconds: 5.4036
Speed Up: 10682

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 1685681 5668 55.35 5149 10291 54.9 274.4 19.4% 0.0% 0.0% 0.0% 5.41sec 1685681 297.41sec
Kyrian_Pelagos Kyrian_Pelagos arcane_echo 342232 186188 626 59.80 527 1054 59.3 296.4 19.3% 0.0% 0.0% 0.0% 4.70sec 186188 297.41sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 2226288 7486 148.67 2531 5063 147.4 736.9 19.4% 0.0% 0.0% 0.0% 1.99sec 2226288 297.41sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.12sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 424827 1428 12.80 5621 11183 63.4 63.4 19.4% 0.0% 0.0% 0.0% 24.12sec 424827 297.41sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.87sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 263.06sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.73sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 20402 69 2.97 1164 2327 14.7 14.7 19.0% 0.0% 0.0% 0.0% 1.73sec 20402 297.41sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 171.48sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1754 6 0.20 1481 2961 0.0 1.0 18.5% 0.0% 0.0% 0.0% 0.00sec 1754 297.41sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 5796 145 135.00 54 108 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 5796 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 31430 106 1.87 2851 5674 9.3 9.3 19.2% 0.0% 0.0% 0.0% 33.74sec 54129 297.41sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 22700 76 12.04 316 634 9.3 60.2 19.2% 0.0% 0.0% 0.0% 33.74sec 54129 297.41sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.07sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 54.45sec 0 297.41sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 362801 1220 5.97 12276 0 5.9 29.6 0.0% 0.0% 0.0% 0.0% 54.34sec 362801 297.41sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.88sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 1785271 6003 56.73 5325 10674 56.3 281.2 19.2% 0.0% 0.0% 0.0% 5.27sec 1785271 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_blast 30451 2 0 0.00 0 2648 0.0 0.0 100.0% 0.0% 0.0% 0.0% 0.00sec 2 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_echo 342232 128953 434 36.44 599 1198 36.1 180.6 19.2% 0.0% 0.0% 0.0% 7.79sec 128953 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 2409567 8102 153.62 2655 5310 152.3 761.5 19.2% 0.0% 0.0% 0.0% 1.92sec 2409567 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 12.9 0.0 0.0% 0.0% 0.0% 0.0% 23.70sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 429725 1445 12.99 5587 11177 64.4 64.4 19.4% 0.0% 0.0% 0.0% 23.70sec 429725 297.41sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.26sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.38sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.51sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 1.74sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 20518 69 2.98 1164 2327 14.8 14.8 19.3% 0.0% 0.0% 0.0% 1.74sec 20518 297.41sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 174.89sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1769 6 0.20 1481 2961 0.0 1.0 19.4% 0.0% 0.0% 0.0% 0.00sec 1769 297.41sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 6519 163 135.00 61 121 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 6519 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 50.48sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.65sec 0 297.41sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 303349 1020 6.11 10028 0 6.1 30.3 0.0% 0.0% 0.0% 0.0% 52.52sec 303349 297.41sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.19sec 0 297.41sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 1673560 5627 54.28 5218 10418 53.9 269.0 19.3% 0.0% 0.0% 0.0% 5.54sec 1673560 297.41sec
NightFae_Dream NightFae_Dream arcane_echo 342232 141358 475 41.30 578 1158 40.9 204.7 19.4% 0.0% 0.0% 0.0% 6.92sec 141358 297.41sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 2216347 7452 142.48 2629 5264 141.2 706.2 19.3% 0.0% 0.0% 0.0% 2.08sec 2216347 297.41sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 22.93sec 0 297.41sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 430408 1447 13.42 5425 10788 66.5 66.5 19.5% 0.0% 0.0% 0.0% 22.93sec 430408 297.41sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 97.22sec 0 297.41sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.77sec 0 297.41sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 8.92sec 0 297.41sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 25440 86 3.70 1164 2327 18.4 18.4 19.1% 0.0% 0.0% 0.0% 8.92sec 25440 297.41sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream NightFae_Dream frostbolt 116 1761 6 0.20 1481 2961 0.0 1.0 18.9% 0.0% 0.0% 0.0% 0.00sec 1761 297.41sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 5790 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5790 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.49sec 0 297.41sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 47.06sec 0 297.41sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 195750 653 4.78 1372 2745 6.0 23.9 19.3% 0.0% 0.0% 0.0% 48.46sec 195750 297.41sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.86sec 0 297.41sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 333496 1121 6.59 10214 0 6.6 32.7 0.0% 0.0% 0.0% 0.0% 48.73sec 333496 297.41sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.89sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 1697651 5708 54.27 5286 10601 53.9 269.0 19.3% 0.0% 0.0% 0.0% 5.53sec 1697651 297.41sec
NightFae_Dream_SB NightFae_Dream_SB arcane_echo 342232 142960 481 41.29 586 1172 40.9 204.6 19.2% 0.0% 0.0% 0.0% 6.90sec 142960 297.41sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 2244238 7546 142.44 2664 5326 141.2 706.1 19.3% 0.0% 0.0% 0.0% 2.08sec 2244238 297.41sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 22.99sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 438230 1474 13.43 5525 11015 66.6 66.6 19.3% 0.0% 0.0% 0.0% 22.99sec 438230 297.41sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 97.16sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.63sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 18.3 0.0 0.0% 0.0% 0.0% 0.0% 9.04sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 25794 87 3.68 1181 2363 18.3 18.3 19.6% 0.0% 0.0% 0.0% 9.04sec 25794 297.41sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1831 6 0.20 1520 3040 0.0 1.0 20.4% 0.0% 0.0% 0.0% 0.00sec 1831 297.41sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 5867 147 135.00 55 109 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5867 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.46sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 47.06sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 198481 662 4.78 1389 2779 6.0 23.9 19.5% 0.0% 0.0% 0.0% 48.44sec 198481 297.41sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.83sec 0 297.41sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 337276 1134 6.59 10334 0 6.6 32.7 0.0% 0.0% 0.0% 0.0% 48.69sec 337276 297.41sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.68sec 0 297.41sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 1705777 5736 54.45 5308 10567 54.1 269.9 19.3% 0.0% 0.0% 0.0% 5.52sec 1705777 297.41sec
NightFae_Niya NightFae_Niya arcane_echo 342232 141255 475 41.30 578 1157 40.9 204.7 19.3% 0.0% 0.0% 0.0% 6.91sec 141255 297.41sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 2268505 7628 142.94 2685 5368 141.7 708.5 19.3% 0.0% 0.0% 0.0% 2.07sec 2268505 297.41sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 22.99sec 0 297.41sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 440038 1480 13.40 5562 11085 66.4 66.4 19.2% 0.0% 0.0% 0.0% 22.99sec 440038 297.41sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 97.15sec 0 297.41sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.65sec 0 297.41sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 18.3 0.0 0.0% 0.0% 0.0% 0.0% 9.05sec 0 297.41sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 25506 86 3.70 1164 2327 18.3 18.3 19.5% 0.0% 0.0% 0.0% 9.05sec 25506 297.41sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Niya NightFae_Niya frostbolt 116 1758 6 0.20 1481 2961 0.0 1.0 18.7% 0.0% 0.0% 0.0% 0.00sec 1758 297.41sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 5792 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5792 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.39sec 0 297.41sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.4 0.0 0.0% 0.0% 0.0% 0.0% 47.05sec 0 297.41sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 196039 653 4.79 1372 2745 6.0 23.9 19.4% 0.0% 0.0% 0.0% 48.42sec 196039 297.41sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.83sec 0 297.41sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 338380 1138 6.60 10361 0 6.6 32.7 0.0% 0.0% 0.0% 0.0% 48.69sec 338380 297.41sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.54sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 1695876 5702 57.57 4974 9963 57.2 285.4 19.4% 0.0% 0.0% 0.0% 5.20sec 1695876 297.41sec
Venthyr_Nadjia Venthyr_Nadjia arcane_echo 342232 137963 464 43.71 534 1067 43.3 216.7 19.3% 0.0% 0.0% 0.0% 6.45sec 137963 297.41sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 2300956 7737 156.56 2485 4971 155.2 776.0 19.3% 0.0% 0.0% 0.0% 1.89sec 2300956 297.41sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 23.42sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 406166 1366 13.14 5232 10452 65.1 65.1 19.3% 0.0% 0.0% 0.0% 23.42sec 406166 297.41sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.15sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 254.21sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 1.76sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 20344 68 2.95 1164 2327 14.6 14.6 19.5% 0.0% 0.0% 0.0% 1.76sec 20344 297.41sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 173.85sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1775 6 0.20 1481 2961 0.0 1.0 19.9% 0.0% 0.0% 0.0% 0.00sec 1775 297.41sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 5786 145 135.00 54 108 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 5786 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 129.62sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 20764 70 1.14 3097 6166 5.6 5.6 19.2% 0.0% 0.0% 0.0% 53.05sec 20764 297.41sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 20999 71 0.55 6402 12816 2.7 2.7 19.8% 0.0% 0.0% 0.0% 132.76sec 20999 297.41sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 49.64sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.63sec 0 297.41sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 307651 1034 6.20 10009 0 6.2 30.8 0.0% 0.0% 0.0% 0.0% 51.49sec 307651 297.41sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.99sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 1697721 5708 56.96 5042 10078 56.5 282.4 19.3% 0.0% 0.0% 0.0% 5.26sec 1697721 297.41sec
Venthyr_Theotar Venthyr_Theotar arcane_echo 342232 135525 456 43.08 532 1063 42.7 213.6 19.4% 0.0% 0.0% 0.0% 6.55sec 135525 297.41sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 2304159 7748 153.64 2537 5068 152.3 761.6 19.3% 0.0% 0.0% 0.0% 1.92sec 2304159 297.41sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.49sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 413754 1391 13.11 5346 10719 65.0 65.0 19.0% 0.0% 0.0% 0.0% 23.49sec 413754 297.41sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.27sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.57sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 14.9 0.0 0.0% 0.0% 0.0% 0.0% 1.73sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 20644 69 3.00 1164 2327 14.9 14.9 19.2% 0.0% 0.0% 0.0% 1.73sec 20644 297.41sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 162.63sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1786 6 0.20 1481 2961 0.0 1.0 20.6% 0.0% 0.0% 0.0% 0.00sec 1786 297.41sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 5799 145 135.00 54 108 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.29sec 5799 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 139.35sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 18911 64 1.06 3033 6078 5.2 5.2 18.8% 0.0% 0.0% 0.0% 55.61sec 18911 297.41sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 19448 65 0.51 6388 12801 2.6 2.6 19.3% 0.0% 0.0% 0.0% 141.36sec 19448 297.41sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 50.70sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.73sec 0 297.41sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 313946 1056 6.10 10391 0 6.1 30.2 0.0% 0.0% 0.0% 0.0% 52.60sec 313946 297.41sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.49sec 0 297.41sec
arcane arcane arcane_barrage 44425 1682809 5658 57.18 4973 9977 56.8 283.4 19.3% 0.0% 0.0% 0.0% 5.25sec 1682809 297.41sec
arcane arcane arcane_echo 342232 116510 392 37.12 531 1062 36.8 184.0 19.3% 0.0% 0.0% 0.0% 7.69sec 116510 297.41sec
arcane arcane arcane_explosion 1449 2274144 7647 154.74 2487 4975 153.4 767.0 19.2% 0.0% 0.0% 0.0% 1.91sec 2274144 297.41sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.65sec 0 297.41sec
arcane arcane arcane_orb_bolt 153640 407003 1369 13.09 5268 10485 64.9 64.9 19.3% 0.0% 0.0% 0.0% 23.65sec 407003 297.41sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.44sec 0 297.41sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.74sec 0 297.41sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 297.41sec
arcane arcane deathly_eruption 322256 20180 68 2.93 1164 2327 14.5 14.5 19.4% 0.0% 0.0% 0.0% 1.77sec 20180 297.41sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 156.60sec 0 297.41sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
arcane arcane frostbolt 116 1751 6 0.20 1481 2961 0.0 1.0 18.3% 0.0% 0.0% 0.0% 0.00sec 1751 297.41sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
arcane arcane_mirror_image frostbolt 59638 5790 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5790 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 297.41sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.18sec 0 297.41sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.15sec 0 297.41sec
arcane arcane touch_of_the_magi_explosion 210833 202287 680 6.17 6618 0 6.1 30.6 0.0% 0.0% 0.0% 0.0% 52.00sec 202287 297.41sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 124.51sec 0 297.41sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
35110.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 38.3sec 7.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 105.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:7.94%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 20.9sec 5.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 36.3s

Stack Uptimes

  • Health Decade (10 - 20)_1:5.93%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 23.6sec 7.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 35.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.77%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.0sec 9.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 39.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.80%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.2s / 46.3s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.18%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.2sec 12.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.7s / 51.6s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.94%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 39.7sec 13.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:32.5s / 50.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.53%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 44.0sec 15.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:33.0s / 55.0s

Stack Uptimes

  • Health Decade (70 - 80)_1:15.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 33.9sec 11.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 51.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:11.56%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.0sec 4.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.5s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.41%
Mirrors of Torment 2.7 0.0 137.4sec 138.6sec 13.2sec 11.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 166.0s
  • trigger_min/max:97.1s / 166.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.19%
  • mirrors_of_torment_2:5.28%
  • mirrors_of_torment_3:1.34%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.9 0.0 128.7sec 129.6sec 13.2sec 12.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.6s
  • trigger_min/max:93.8s / 162.6s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.57%
  • mirrors_of_torment_2:5.69%
  • mirrors_of_torment_3:1.44%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.3 27.5 33.2sec 7.8sec 4.8sec 14.95% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.87%
  • radiant_spark_vulnerability_2:3.76%
  • radiant_spark_vulnerability_3:3.56%
  • radiant_spark_vulnerability_4:3.76%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.1 0.0 52.0sec 52.1sec 7.9sec 16.35% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.1s
  • trigger_min/max:46.3s / 67.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.35%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.44% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:41.6s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.44%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.43% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:40.2s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.43%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.45% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.5s
  • trigger_min/max:41.5s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.45%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.6sec 52.7sec 7.9sec 16.14% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 67.1s
  • trigger_min/max:46.3s / 67.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.14%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.5sec 51.6sec 7.9sec 16.43% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 65.5s
  • trigger_min/max:46.3s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.43%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 5.9 0.0 54.2sec 54.4sec 7.9sec 15.77% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 69.7s
  • trigger_min/max:47.4s / 69.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.77%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.5sec 52.6sec 7.9sec 16.18% 0.00% 0.0 (0.0) 5.9

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 68.2s
  • trigger_min/max:46.3s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.18%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
Fluffy_Pillow Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1121
Mean 37148.45
Minimum 35481.64
Maximum 39541.25
Spread ( max - min ) 4059.61
Range [ ( max - min ) / 2 * 100% ] 5.46%
Standard Deviation 639.7348
5th Percentile 36143.06
95th Percentile 38186.12
( 95th Percentile - 5th Percentile ) 2043.06
Mean Distribution
Standard Deviation 19.1072
95.00% Confidence Interval ( 37111.00 - 37185.90 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1140
0.1 Scale Factor Error with Delta=300 3494
0.05 Scale Factor Error with Delta=300 13975
0.01 Scale Factor Error with Delta=300 349369
HPS
Fluffy_Pillow Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 201
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11840139 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
22797.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 40.4sec 8.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 117.1s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.80%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 23.6sec 6.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 39.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.77%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.4sec 8.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 36.3s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.71%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 31.7sec 10.72% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.2s / 42.0s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.72%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.5sec 11.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.3s / 44.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.67%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.4sec 12.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.5s / 51.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.05%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.0sec 12.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:31.2s / 44.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.59%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.8sec 13.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.9s / 49.5s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.90%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 30.4sec 10.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.9s / 43.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.35%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.2sec 4.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.50%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1438
death count pct 126.47
avg death time 294.68
min death time 240.03
max death time 355.44
dmg taken 7159269.67

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
enemy2 Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1121
Mean 24082.52
Minimum 23258.33
Maximum 25077.30
Spread ( max - min ) 1818.98
Range [ ( max - min ) / 2 * 100% ] 3.78%
Standard Deviation 346.4969
5th Percentile 23509.76
95th Percentile 24622.32
( 95th Percentile - 5th Percentile ) 1112.55
Mean Distribution
Standard Deviation 10.3490
95.00% Confidence Interval ( 24062.24 - 24102.80 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 796
0.1 Scale Factor Error with Delta=300 1025
0.05 Scale Factor Error with Delta=300 4100
0.01 Scale Factor Error with Delta=300 102491
HPS
enemy2 Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 201
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8398144 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
22773.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 41.7sec 8.63% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 119.1s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.72%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 23.6sec 6.65% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 38.8s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.66%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.5sec 8.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 36.6s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.66%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 31.7sec 10.71% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.5s / 41.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.71%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.4sec 11.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.6s / 43.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.66%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.6sec 12.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 50.9s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.10%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.1sec 12.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.4s / 44.2s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.64%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.0sec 13.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.8s / 49.4s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.97%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 30.6sec 10.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 44.6s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.45%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.3sec 4.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.53%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1438
death count pct 126.47
avg death time 294.68
min death time 240.03
max death time 355.44
dmg taken 7158808.52

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
enemy3 Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1121
Mean 24081.41
Minimum 23104.83
Maximum 25151.16
Spread ( max - min ) 2046.33
Range [ ( max - min ) / 2 * 100% ] 4.25%
Standard Deviation 342.6602
5th Percentile 23524.33
95th Percentile 24629.64
( 95th Percentile - 5th Percentile ) 1105.31
Mean Distribution
Standard Deviation 10.2344
95.00% Confidence Interval ( 24061.35 - 24101.47 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 778
0.1 Scale Factor Error with Delta=300 1003
0.05 Scale Factor Error with Delta=300 4010
0.01 Scale Factor Error with Delta=300 100234
HPS
enemy3 Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 201
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8744112 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
22733.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 41.5sec 8.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 121.6s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.98%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 23.6sec 6.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 35.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.68%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.3sec 8.66% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 36.5s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.67%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 31.7sec 10.73% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.1s / 41.8s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.73%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.3sec 11.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.5s / 44.2s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.60%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.4sec 12.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.9s / 51.1s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.04%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.0sec 12.61% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.8s / 44.4s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.61%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.8sec 13.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.7s / 49.4s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.90%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 30.4sec 10.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.1s / 45.1s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.36%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.2sec 4.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.49%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1438
death count pct 126.47
avg death time 294.68
min death time 240.03
max death time 355.44
dmg taken 7159559.54

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
enemy4 Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 1121
Mean 24082.78
Minimum 23087.01
Maximum 25306.14
Spread ( max - min ) 2219.12
Range [ ( max - min ) / 2 * 100% ] 4.61%
Standard Deviation 347.7988
5th Percentile 23530.32
95th Percentile 24632.39
( 95th Percentile - 5th Percentile ) 1102.07
Mean Distribution
Standard Deviation 10.3878
95.00% Confidence Interval ( 24062.42 - 24103.14 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 802
0.1 Scale Factor Error with Delta=300 1033
0.05 Scale Factor Error with Delta=300 4131
0.01 Scale Factor Error with Delta=300 103262
HPS
enemy4 Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 201
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8432394 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy4"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
23236.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 41.7sec 9.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 118.6s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.34%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.3sec 7.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:1.4s / 34.9s

Stack Uptimes

  • Health Decade (10 - 20)_1:7.20%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 27.2sec 9.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 37.2s

Stack Uptimes

  • Health Decade (20 - 30)_1:9.04%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.5sec 11.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.3s / 43.4s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.2sec 11.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.7s / 46.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.92%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.8sec 12.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.3s / 51.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.17%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.2sec 13.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.7s / 44.0s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.01%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.0sec 13.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.2s / 51.2s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.97%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 24.5sec 8.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.9s / 40.8s

Stack Uptimes

  • Health Decade (80 - 90)_1:8.35%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 15.9sec 4.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.5s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.04%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1438
death count pct 126.47
avg death time 294.68
min death time 240.03
max death time 355.44
dmg taken 7331174.29

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 1121
Mean 297.41
Minimum 240.03
Maximum 359.96
Spread ( max - min ) 119.94
Range [ ( max - min ) / 2 * 100% ] 20.16%
DPS
enemy5 Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 1121
Mean 24660.65
Minimum 23823.31
Maximum 25444.39
Spread ( max - min ) 1621.08
Range [ ( max - min ) / 2 * 100% ] 3.29%
Standard Deviation 327.9135
5th Percentile 24127.17
95th Percentile 25171.98
( 95th Percentile - 5th Percentile ) 1044.81
Mean Distribution
Standard Deviation 9.7939
95.00% Confidence Interval ( 24641.46 - 24679.85 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 680
0.1 Scale Factor Error with Delta=300 918
0.05 Scale Factor Error with Delta=300 3672
0.01 Scale Factor Error with Delta=300 91792
HPS
enemy5 Healing Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 1121
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 201
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 7054033 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy5"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.